SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312280|ref|YP_007123257.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312280|ref|YP_007123257.1|
Domain Number 1 Region: 673-831
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-34
Family Histidine kinase 0.0051
Further Details:      
 
Domain Number 2 Region: 247-358
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.62e-20
Family Flavin-binding PAS domain 0.07
Further Details:      
 
Domain Number 3 Region: 387-487,552-588
Classification Level Classification E-value
Superfamily GAF domain-like 2.82e-18
Family GAF domain 0.0079
Further Details:      
 
Domain Number 4 Region: 25-149
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.18e-16
Family Heme-binding PAS domain 0.067
Further Details:      
 
Domain Number 5 Region: 601-680
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000126
Family Homodimeric domain of signal transducing histidine kinase 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312280|ref|YP_007123257.1|
Sequence length 834
Comment bacteriophytochrome (light-regulated signal transduction histidine kinase) [Microcoleus sp. PCC 7113]
Sequence
MDISFNPNISTSGNDFDDLQNPQSLARRLETSEARIYGLLATLPQIVWLAQINGSVTNFN
PRWYEYTGLTASESLGWGFLKAIHPEDRDSLWPSYAASAVVSESVASNPGGCDPIECRIR
DSDGIYRWFIGQRMPVKDTQGQILEWVAIYTLKDQPLYPINHSVGDQERGKSNISSSLKP
ARASSFALSSFASSSSRSNFSVCSPDPKSFGRRIELTPVLATLSQQESTLCDIPKSAQHR
RRNWLNELSHTIIWETDATTEQFTFVSHSAEQVLGYPVEQWLENPDFWVNLIHPEDRQWT
VAVCRKKIIQDRDYELEYRCLTADHRVVWLRDRAYMIRDEQGQVHKRRGLMVDITLAKLA
EVELQARLRQQAAIAQLGQQALLRAPLSSLMDECLNLICQILGVEYCQVWEWLPDNNTLK
LRAGFGWREGLVGQALIDASANTQAGYTLQSGQPVVVENLRGETRFQGSPLLHEHDICSG
LSVIMGGMSLTRQEGEEELPDIALESQQEQQNSSTQDEPPTFAPALLTRTPLPSSLQRRY
LPELNGATLSRQPWGVLAAHTSRQRVFSQSDVDFLQSVANVLAGAMQSQQTDAALYEATA
QLAQTTAALEKRSKELDEFAYITSHDLKAPLRAIANLSQWIEEDIAHQLDAENRHQLQLL
RGRVYRLEALIEGLLQYSRAGRLKSEPQEVDVGLLLKHVIDTLNPHAQFRIIIAPGMPTL
MTERLPLERVFTQLIDNAIKHHPLADGTVMIGIEEQPDAYEFRVVDDGLGIAPQFHERVF
GIFQTLQAKDTHENTGLGLAIAKRIVEGKGGTIRLESQEGQGATFYFTWPKVLR
Download sequence
Identical sequences K9WJ62
WP_015183987.1.75295 gi|428312280|ref|YP_007123257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]