SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312289|ref|YP_007123266.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312289|ref|YP_007123266.1|
Domain Number 1 Region: 277-422
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000319
Family GAF domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312289|ref|YP_007123266.1|
Sequence length 798
Comment hypothetical protein Mic7113_4159 [Microcoleus sp. PCC 7113]
Sequence
MPTRKPSSHVENVQSTKDLKLGANAQSQDELSTTSSESESQSSPNFLDELVNAFLDDDHL
LDSEDEPIQPMKKKSNGLSHFQHHSQLLMAVVDPGSFTLRYANDYFWTLMGMAETGTQLK
GQEIQLPDLLPDLKGTAIDSLYRQHILHLIFRDIYQIKVPRSRLLDQPVIVSLKSPLYSE
PRWIELAFRSEQLKISRLDAQIDELADLDLQPWRVEEGTVQSIDWEPLEAWKQRLRLDNY
QLTGQLLLEGSDVTERETIRHIIGLLIDRDSILRPDKFRRINKRLRSLFRATNSLIMSTE
NEHTRLFMSTERKELRATVHSLESLAGSHFLRAADANRVWNVPDLTQDCLTDSERALLNQ
GVRSMLLIPLVVKPLKSGKGSRQLAGIVGIMSDRPHNFDGVDCKYAEELMPAFTAALRQA
IQQRFTNIHPSVEWRFLQEAERRSWGLAAEPIVFANVYPLYGISDIRGSSEERNRAIQSD
LLEQFHQGLQVVDAVCQFQKSSLGEQLRLDLLEYIEHLKERVTVDAEVTALKFLSDRLEL
YLDYFAQCGADAQAAVETYRQSCNNDHKSVYVSRAHYDKTISQINALLKQTWERWQVRMQ
QIISHYCDVESTDGINHMIYVGESIDSKFSIYHLRSLRYEQLRAVCDCARTAFKFQTLYN
TQMEVTHLALVQDQTVDIIHDENTEKLFEVRGTRDIRYEIVKKRIDKAVDEESRTRITQP
GMVTLVYSTEEEWSEYQQYLRYLAREGWVDTEIQSGTVEPLQGITGLKFARVRVLPSTEG
EELELATPSDAVEEAVVQ
Download sequence
Identical sequences K9WHG7
WP_015183996.1.75295 gi|428312289|ref|YP_007123266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]