SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312363|ref|YP_007123340.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312363|ref|YP_007123340.1|
Domain Number 1 Region: 50-134,165-239
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000414
Family GAF domain 0.011
Further Details:      
 
Domain Number 2 Region: 297-489
Classification Level Classification E-value
Superfamily PP2C-like 0.0000173
Family PP2C-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312363|ref|YP_007123340.1|
Sequence length 492
Comment serine phosphatase RsbU, regulator of sigma subunit [Microcoleus sp. PCC 7113]
Sequence
MFPTPDAMTARPAPRQPSSSTDSNSHKTTAEGTPVSALKELVARLHREQHKIQDLLSSLG
FALRSFNNLNQFLELIPLMAARVTDADGGALILFKPNGQVRLEQLHCQESQACNNIRKAI
EKATREVRATNSDGGTDSNAPVPLELLQTSLDDQVSQSLGADVQLFGTPILIRNSERGRL
YVFSHDSNYNWTPTRQKLVRLVADQTAVAIANDELTVELRKKERLDRELEIGAEIQLRLL
PRQCPEIEGVELAAMCKTASRVGGDYYDFIPANYDQFRSKKPDDQEVTDCKRASLPWSVV
IGDVMGKGVPAGLIMTMTRGMLRAEVLNRHSPGRILEHLNRVMYADLENSHRFVTLFYSE
YDPQTQLLTYSNAAHNPPFLWQASTQSIHRLDTEGMLIGLEADSQYEDAQVQLAPGDTII
YYTDGFTDAANQSGERFDEENLIQAFQWACEHCSGSQAILDYLFEQVQQFIGSTNPHGDD
MTLVVMQVKSTE
Download sequence
Identical sequences K9WJI1
gi|428312363|ref|YP_007123340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]