SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312365|ref|YP_007123342.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312365|ref|YP_007123342.1|
Domain Number 1 Region: 810-1007
Classification Level Classification E-value
Superfamily GAF domain-like 7.63e-55
Family GAF domain 0.00092
Further Details:      
 
Domain Number 2 Region: 1084-1265
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-39
Family Histidine kinase 0.00071
Further Details:      
 
Domain Number 3 Region: 1292-1424
Classification Level Classification E-value
Superfamily CheY-like 8.11e-38
Family CheY-related 0.0024
Further Details:      
 
Domain Number 4 Region: 543-669
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.72e-24
Family Heme-binding PAS domain 0.074
Further Details:      
 
Domain Number 5 Region: 1014-1096
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.69e-22
Family Homodimeric domain of signal transducing histidine kinase 0.00086
Further Details:      
 
Domain Number 6 Region: 668-800
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.64e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 7 Region: 423-544
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000907
Family Heme-binding PAS domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312365|ref|YP_007123342.1|
Sequence length 1499
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MQSLNRLAARVAGKVPLRTVLIVPFVLQIVGTVGLVGYLSFKSGQKAVEDLAHQLMDEVG
ERVEQNLQHYLNVPKQMNQSLADAIRTRVLDWKNFSGLERYFAQQLQVYDTVSTVAIATE
QKEFLAVEKALATDALIIRVLNKSTNYAFHYYAANRQGKRIKLTKVRNDYDPHNDPPQGR
PWYQAAQKAGQAIWLPVVNLSQGVDHPILTMVNFLPFDNADGKFQGVLAAAVYLPHFATF
LEQLKIGETGQVFIIDRQGLLIASSTGETPFQPKLELDYLKNLNPQQWRLSAQNSKNYLT
QASVKFLLSQMKNLHQIKQKKNLNFDFYHNRYFLQVNPVSNQSELDGLIITVVPEADFMK
QIYANTRTTSLLCIAALIGSITIGILTARWITQSILCLNTLEDKVAERTAELSHVNELLI
QEIAERVLIEGKLHSSTHQVRTIFESITDIVLIIDEQKNIQIIPTKILGSSRHETGWLNS
IVEEFFQQEDTQESWFAQVRQVLATHQSINFDYSIRINNRDVWFTACLSPFPDNSVVWVA
RDISDRKLAEQALIESEARFQAFMNYSPLLAWISDGDGKVLYCNRSVELWSQRAASELIG
ETIFALHPPNIAQEHLENIRYVINTREVLETNESAFTADGTLHDFLTYKFPLIDANGQCL
VGGIAADITIRKRAEETLQDSQARLQKLTNNVPGSIYEFVLHPDGSNSLEYTSSAVRDIH
ELEPEQVLENATLLFDHIHPDDRASYSVAVEISAQTLELFHHEWRIITPSGKLKWLQATS
KPERRSNGDIVWYGAVFDITDKKQAEDALRESANRERAIAQVLQRMRQSLDINTIFSTTT
EELRRVMKCDRVVIYQFNPDWSGRFVAESVASGWKTLLLAQSNIPHLTDDILESENCAVR
AWGVINEPIQDTYLQATQGGIYSQSDSYLASEDIYNTGLSPCHIKLLERFQARAYLIVPI
FCGKKLWGLLASYHNTSSRPWSASEINTVVQIGIQLGIALQQAQLLAETRQQSVALQQAA
YAADAANRAKSTFLANMSHELRTPLNGIMGYAQILQGDKNCTPKQKEGVDIIYQCGTHLL
TLINDILDLSKIEAERLELYPEDIHLPTFLAEMSEIFKLKSIQKDIHFTYLPLNSLPTGI
QADNKRLRQVLMNLLSNAVKFTDRGSVTFKVGRIDNDRQEQSPITHQPSPITKIRFQVED
TGIGIPPDQLEKIFLPFEQVGDKSRRSEGTGLGLAISQKIVEMMESKIWVESTLGVGSRF
CFDLSLPEILTPTLPMRVKSTESIIGYSGLKKKILVVDDRWENCAVLINMLEPIGFEVLE
AANGQEGLEKALEFQPDLILVDLVMPMMDGFEMTRQLRLFTQLKDTVVIAISANAFALDR
QKSLESGCNDFLTKPVQAEELLTKMKDYLNVSWIYQERRWEQASTNSPEMVIPAHEELMN
LYEAAQSGDIEGVEQECMRLQDLSSEYISFVIRVLKLAQAFEYEEIAKLIDRYLSQDSQ
Download sequence
Identical sequences K9WJE5
WP_015184072.1.75295 gi|428312365|ref|YP_007123342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]