SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312366|ref|YP_007123343.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312366|ref|YP_007123343.1|
Domain Number 1 Region: 33-182
Classification Level Classification E-value
Superfamily CheY-like 4.84e-39
Family CheY-related 0.00056
Further Details:      
 
Domain Number 2 Region: 431-617
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-38
Family Histidine kinase 0.0033
Further Details:      
 
Domain Number 3 Region: 191-298
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.84e-28
Family Flavin-binding PAS domain 0.00084
Further Details:      
 
Domain Number 4 Region: 337-377,407-437
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000961
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312366|ref|YP_007123343.1|
Sequence length 621
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MPLDQEFQSNLIPKQNLPIPDLQLNDSVKTGEILLVDDTNANLKLISDFLRESGFKVRGA
KSGWKALKILEITSPDLILLDVVMPEMDGFETCRRLKEWDKTKDIPVIFMTAIADASHPE
HKVQGLALGAVDYISKPIQLAEVLARVKTHLHLRFLTKQLQAQNAHLCAEIEVRRKTEEQ
LRLLERAIAASSNGILISDPHQAGNPVIYANSGFERITGYKREDILGKNCRFLQGTDTKQ
PALDELHRAIAKGQGTQVVLRNYRKDGTLFWNEFCLNPVRDEAGHLTHFIGVQTDITEHK
KREEELQQAKAREKEKAQALEQTLGELKRTQTQLIQTEKMSSLGRMVAGIAHEINNPVSF
IYGNLTPAKEYFQGLTQLIELYQQAYPKPTPEIQHFIEEIDLEFLLEDWSKVIHSMQIGA
ERIEQTVLSLKSFSRLDESELKPVDIHENIDNTLLILQHRLRAEGNRPEIKVMKDYGQLP
RVYCYASQLNQVFMNLINNAIDALESQPQPRVITISTALGQNSKIKIQNEQGQTPNPPIP
SPNPQYAIIQIADNGIGMCEEVCQQIFDPFFTTKSVGSGTGLGLAISHQIIVEKHQGQIR
CISLPGQGTELIVEIPINLAI
Download sequence
Identical sequences K9WK80
WP_015184073.1.75295 gi|428312366|ref|YP_007123343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]