SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312412|ref|YP_007123389.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312412|ref|YP_007123389.1|
Domain Number 1 Region: 692-864
Classification Level Classification E-value
Superfamily GAF domain-like 3.93e-56
Family GAF domain 0.00017
Further Details:      
 
Domain Number 2 Region: 997-1098,1133-1204
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.32e-34
Family Histidine kinase 0.01
Further Details:      
 
Domain Number 3 Region: 576-683
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-29
Family Flavin-binding PAS domain 0.0012
Further Details:      
 
Domain Number 4 Region: 298-430
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.03e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.042
Further Details:      
 
Domain Number 5 Region: 197-302
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.25e-22
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 6 Region: 429-557
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 7 Region: 14-151
Classification Level Classification E-value
Superfamily CheY-like 0.00000000000000498
Family CheY-related 0.03
Further Details:      
 
Weak hits

Sequence:  gi|428312412|ref|YP_007123389.1|
Domain Number - Region: 908-948,978-1008
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000432
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312412|ref|YP_007123389.1|
Sequence length 1204
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MTSTLKPTLNRDAFRVLLVEDNLTEAQRLQEVLLEAQGENILLTHVKSITETIEALSQEN
FDVVLFDLSLPERNDLHPLARVHEYISSPKNGACPAIIVIIEDDDQTLALQCLSAGVQDF
WKKGKLSHIPLMNSLRYAIARRDAIASVAHQKMREALLRNQEEYQCVISDLPEVIDPPEP
QPSQQEFVSQEEQRFFTLSLDLLCIAGVDGYFKQLNPVWETTLGYTISELLNQPILKLVH
PDDRKASRRAVQKLKNGSIPSLKFENRFIGKDGSYRWFSWTMVSFFQEGLIYAVARDITE
RKHSEAALQSSEARYRTLVSNIPGAVYRGKCDADWTIEFFSQEIERISGYPASDFIANYK
RNLTSIIYPEDVESVNCAIRDALGTKQPFSLEYRIIHKNGSIRWVYEKGHGIFKTKGELL
CLDGVIFDITERKQAEAELHRTQQFLNSLLDNLPVGVFAKEAQKLQFVFWNKTLTELIGY
SANEVIGKTDSDLFSADHANFSKAQDQEAFLIGKLIDNPAEPIPTHRGQRIFHVKKIPIF
DEVGRPQYVLGIADDITERQQTIDRLRLLERAIAASSNGIVITDATDSNHPLVYANPGFE
RITGYSVEEVMGQNCRFLQGTDREQPALTELRTALQQERECRVVLRNYRKDGSLFWNEFS
ISPVRNSAGILTHYIGVHRDITELKQAEAALRQQVLREHLVGAMRSRIRRTLNLKEVLTT
AVEEVRQFLQTDRTVIYRFYPDWSGVIAVESVGEDWTPLFGLDIQDNCFAQNYTSQYQQG
RIRAVDNIHQADLRQCHIDLLSQLEVKANLVVPLLQGETLWGLLIAHHCRDSRAWDSFEI
ECLSQLSVQLAIAIQQSTLFEQAQTELLERKRVEENLRRSEARERKRAKQLLIALHDLKN
AQTQLVQTEKMASLGQLVAGVAHEINNPTSFISCNVAPALGYTDDLLNLISLYQKYYPTP
PAEIENEIVAIDLDFIKEDFPKLLRSMQKGASRIQEIVLSLRNFSRLDEAERKKVDLHQG
IDNTLMILQNRLREQSSRAAIQVIKEFGSLPLVDCYPSELNQVFINILSNAIDALECRMK
KDASLTPQIRICTQVLSSRKRTGNSQNSQGQCPITHSPCSIAKGQFPIPFTDKVVIRIAD
NGIGIPENVNLRVFDPFFTTKPIGKGTGLGLSISHSIVVKKHKGELYYHSPDGQGTEFVI
ELPF
Download sequence
Identical sequences K9WIF3
gi|428312412|ref|YP_007123389.1| WP_015184119.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]