SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312418|ref|YP_007123395.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312418|ref|YP_007123395.1|
Domain Number 1 Region: 743-929
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.83e-67
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000231
Further Details:      
 
Domain Number 2 Region: 556-688
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-20
Family Flavin-binding PAS domain 0.056
Further Details:      
 
Domain Number 3 Region: 436-557
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.089
Further Details:      
 
Domain Number 4 Region: 369-419
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000262
Family HAMP domain 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|428312418|ref|YP_007123395.1|
Domain Number - Region: 83-163
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), middle domain 0.0497
Family delta-Endotoxin (insectocide), middle domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312418|ref|YP_007123395.1|
Sequence length 932
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MLKRLLKNTKNMQLRLLLVLPFVLQIFIAVGVISYLSIRNGQQAVNEVASELSREIGDRI
QLRLQTYLEIPHQVNQFHADAIDSGLENLDNLPTLDRFLWRQIHKFDTLTSINISTPNKG
YIGIIRREDGSITIGITDKTTGRHQSWATDHQGNRTKILRTNPNNQYWEQPRYQAALKAG
KPTWTEISLSSNPAYLRVWATQPVYDPRGKLLAVTSSSLSLSQISQFLRGLKIGQTGQTF
IMERNGRLIATSTSEEPFYLPQNTQKPERLLGVNSTNPLTRSTAKYLAAIFSNFTQINSS
QSLEFQLEGKRQFLQVIPFRDVGGLDWIVVVVVPESDFMEQIHANTRMTILLCFLALMLA
LLLGLITSRWITQPIIRLSAASRAIARGELDQYVEVQGVGELRVLATFFNQMVVQLRESY
KVLKQTNEQLESRVEERTAALRLSEEKFALSFRCSPHPIAITTLLDGCYIEVNESFLHLC
GYELQEVIGHTTHELQIWANPEEYTWIIQWLDVEGAVRDWEVRFRTKLGEVRTVLLSAEK
IELAGEVCLLCIGNDITERKLMEKALREQKEYLRLILDNIPLQVFWKDANLVFLGCNQNW
AKAAEINHPEAVVGKTDYDVLPNREIADLFRVQDRRIMETMTPELHIVASKPRPSADGQT
VWLDISKIPLQDSTGKVIGILGVVEDITLRKKAEEALRVEQEKSERLLLNILPKAIAEQL
KQNLWNFRENGFAKSNGAMLIAEQFDDVTIMFADIVGFTPLSARISPQALVNLLNEIFST
FDELVEKHGLEKIKTIGDAYMVAGGLPMPREDDAEPMTNGDIASRTAQMALDMQTAITQF
EADKGEPFQIRIGINTGPVVAGVIGMKKFIYDLWGDTVNVASRMESQGMPGRIQVTATTY
ERLQNQYLLEKRGTIPVKGKGEMTTYWLIGSR
Download sequence
Identical sequences K9WJN9
WP_015184125.1.75295 gi|428312418|ref|YP_007123395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]