SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312420|ref|YP_007123397.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312420|ref|YP_007123397.1|
Domain Number 1 Region: 1502-1674
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.16e-48
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 405-571
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.2e-46
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 3 Region: 633-769
Classification Level Classification E-value
Superfamily CheY-like 1.85e-41
Family CheY-related 0.00053
Further Details:      
 
Domain Number 4 Region: 1692-1813
Classification Level Classification E-value
Superfamily CheY-like 5.27e-32
Family CheY-related 0.0054
Further Details:      
 
Domain Number 5 Region: 1006-1132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 6 Region: 1281-1411
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.58e-27
Family Heme-binding PAS domain 0.051
Further Details:      
 
Domain Number 7 Region: 880-1006
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.61e-25
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 8 Region: 791-892
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.036
Further Details:      
 
Domain Number 9 Region: 337-417
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.92e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 10 Region: 1436-1513
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.9e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 
Domain Number 11 Region: 1147-1282
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.9e-16
Family Heme-binding PAS domain 0.03
Further Details:      
 
Domain Number 12 Region: 202-340
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000294
Family GAF domain 0.02
Further Details:      
 
Domain Number 13 Region: 48-154
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00004
Family Heme-binding PAS domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312420|ref|YP_007123397.1|
Sequence length 1815
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MTQQGEEIALEQLFAGGGETGAMMRSLDWSRHPLGSVDQWPQSLKTMVRIMLTSRQPMFV
WWGEQLINLYNDAYKSIVGGKHPKALGQPASEVWREIWDQVGPRAESAMLKNEGTYDEAL
LLIMERNGYPEETYYTFSYSPVPNDQGGTGGIICANTDDTQRIIGERQLSLLRELAAKTA
DARTFDDACTRSAKCLETNPYDLPFAMIYLVDPGQKCVVLTGTSGIDRTHAAVPETIALD
SDSPWPFAEAIAMHKPCLVADLEALFGNLPMGAWQRPPHQAVVVPIAPSGQTGQAGILIV
GLNPFRLFDDNYRGFIDLVAAQIAASIANAQAYEEERKRAEALAELDRAKTIFFSNISHE
FRTPLTLMLGPLEEMLANSARLLPSERSHLETAHRNSLRLLKLVNTLLDFSRIEAGRVQA
VYEPTDLAMFTADLAGMFRCAIEQAGMRLCVECPPLPEPVYVDREMWEKIVLNLLSNAFK
FTWEGEITVALGWANDHVELEVRDTGTGIPAEEMPHLFERFHRVEGARGRTYEGSGIGLS
LVQELVKLHGGTIQVSSVVDRGSCFTVVIPTGYAHIPKERISTPRTLASTAIGAATYVEE
ALRWLPEGAGEPGSRGAGEPGREVYPVSLNSCVPSAHILLADDNADMRDYVKRLLVTQGY
EVETVGDGIAALARIHERTPDLVLTDVMMPRLDGLGLLRSLRDDPRTREIPIILLSARAG
EKSRIEGLEAGADDYLIKPFSARELLARVEASLKLAQMRQEAASREEVLRAEVQSAKDTL
ENVLSRIRDQFLALDQDWRYTYTNDRVVEVTGKSREELLGKSIWELYPDTIGSQFQIEVQ
RAVAEQIPIQFEYFYPSLNRWFENRIYPSADGLSVFVADITNRKQAEEALQQREAELQLI
TDTVPALIAYVDRDCRYRFANRAFTRWFGKLVEEIIGQRVEEFVGETAYQYIRSDIEKAL
TGESVTSELWVPFRDGGSRYVRRQYIPDIDAQGEVRGFFAMITDLTDLKRTQEAFRASEE
RFSVIVNQATVGIAQMDLTAQFVLVNQKYCDIVGYPMAELLHKRKQDITHPEDLPYNMEL
FHRLVTRGESYALEKRYIRKDGSEVWVSNYVAAICDASGKPESAISVVLDISEQKAALRE
RQQAEAERERLLQELAIERARFEAVLRQMPAGVMIADAASGKLVLTNEQAKQIVGYDYEQ
SIQLAEYNQIVPFEGFRSDGQLYNPEDYPLMRSLQTGETITNEEIELQRGDGSHIVMNAN
SAPILDSKGQIIAAVVVFQDITERKRAEEALRQALLKLNFHVENTPMAVVEWDRDFRIIR
WSAAAERILGWKAEEVIGKQLTELRFVYEEDAEAVAEVCRRLVYSEEPHIVGYNRNYTKD
GDIVHCEWYNSSLRDELGRMTSVLSLVLDVTERKRAEQEREQLLKREQAARAESEAARSA
AETANRIKDEFLAVLSHELRSPLNPILGWSRLLQTRKFDAAKTAEALATIERNAKLQAEL
IEDLLDVSRILRGKLSLNITSVALTSTIQAAMETVRLAAEAKSIQMSTKLEPQVGKVSGD
ASRLQQVVWNLLSNAIKFTPPGGRVDIQLERIDSYAQIVVSDTGKGIPVDFLPHVFDYFR
QADATTTRKFGGLGLGLAIVRHLVELHGGTVQADSAGEGQGATFTVRLPLLLSPPQSDQD
SEQPEPSLDLQGIEILVVDDDIDTREFVAFLLEQYGAQVTAVGTAGEALAALSQSVPDVL
LSDIGMPEMDGYMLMQKVRTLPPEQGGQIPAIALTAYAGEINYQQALSAGFQSHLSKPVE
PAELVALVTKLAQRQ
Download sequence
Identical sequences K9WJJ5
gi|428312420|ref|YP_007123397.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]