SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312463|ref|YP_007123440.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312463|ref|YP_007123440.1|
Domain Number 1 Region: 3-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-53
Family Protein kinases, catalytic subunit 0.0000719
Further Details:      
 
Domain Number 2 Region: 1871-1953,1983-2070
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-32
Family Histidine kinase 0.0032
Further Details:      
 
Domain Number 3 Region: 1424-1616
Classification Level Classification E-value
Superfamily GAF domain-like 1.18e-24
Family GAF domain 0.0058
Further Details:      
 
Domain Number 4 Region: 1601-1728
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000381
Family PYP-like 0.043
Further Details:      
 
Domain Number 5 Region: 388-635
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000363
Family Nucleotide and nucleoside kinases 0.069
Further Details:      
 
Domain Number 6 Region: 853-962,1303-1369
Classification Level Classification E-value
Superfamily TPR-like 0.0000263
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number 7 Region: 1779-1819,1849-1880
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000432
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312463|ref|YP_007123440.1|
Sequence length 2077
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MLLLNNITVKATIYESANSLVYRGIKNYDNTPVILKVLKEDYPSPQEIVRYKKEYAITHS
LNLEGVIKAYSQQEYQRSLVIVLEDFGGESLKKWMKLSPQGYYPMPLPEFLSLAIKITKI
LGNIHSSNVIHKDINPGNIVLNPETGQVKIIDFGISTRLPSNSPPLVHPHGLEGTLAYMS
PEQTGRMNRTLDYRTDFYSLGVTFYELLTGKLPFTTDDVLELVHCHIAKQPVPPKEGRRQ
TGALVRTGGRREEVPQSVSDIVIKLLAKNAEDRYQSAWGIQADLEECLRQVKATGRVENF
RLGSQDISNKFQIPQKLYGREAEIETLLAAFKRVAGGELTSPPIPLLPEEGSPTSPFHKE
KVSSSVLPPRRMDRGGLEGRGGLGCVEMMLVAGYSGIGKSALVQEIYKPITEKRGYFISG
KFDQLQRNIPYSAVVHAFGGLMRQLLSESEAQLRQWQEKILAALGPNAQVIIDVIPEVEL
IIGKQPPVPELGGAESQNRFNLVFQNFIRVFCTKEYPLVIFLDDLQWVDSATLKLIELMM
TDIDTQYLLLIGAYRDNEVNSTHPLMMVLDELRRQEATINQITLAPLKLEHISHLIADTL
HSDTDSVKPLAELVKGKTEGNPFFVNEFLKTLYAENLLVFTPPTPLVNGGVREDSLFKGE
EREHSLTSGGVQEKLINSPSYQGGVRGGRSLWQWDIAQIEAQNITDNVVELTIAKLKKLP
QSTQEVLRLAACIGANFDLNTLSIICQKSEAVIFQDLLIAIESGLILPVSEFNTELLIQD
YRFLHDRVQQAAYALIDESQKQVVHLQIGRNLLEKTSPEQRSERLFEIIDHLNQGLELVT
ARSERTEIARLNLMAGQKAKAATAYDAAFKYFTTGIQRLNSESWQSEYDLTLALYSEAAE
AAYLQGCFDEMEQLIEVVLVHAKTVVDKVQVYDSSIQRYLSQGNLKEALKTGLEALKLLG
IDLIENPSQADTQRELESTAALLAEREIEDLINLPEIAAPEPLAAITILSNMGSAAFITL
PALWILIICKTVNLSITYGNTIWSPMYYAAYGFVLCGVVQDIELGYKFGQLAITSAERLN
NKRGKARTLRFSGTHIMQWKVHLSNTIPMLADAYQSGVETGDFECAGYAAYNLCYNSFSA
GEELTQLEQKTATYSKATNQIRRESPSNWLAIVWQTILNLLDRSENPSRLVGRVCNEEEA
LSHAIAVKDGTVIQILYLHKVMLCYLFEEHHQAVQTAILARKHFEQVSAIMILPVFCFYY
SLALLSLSLDASNSEKAAWLNCVNTNQEKMQKWAEHAPMNYLHKFYLVKAEKARVLGQFL
EAEEFYERAIDGAKENGYLQEEALAYELAAKFYLERGRLRFARTYMKEAHYTYTIWGAKA
KVNDLEAKYPQLLTKSSTAKSITSTRTTHPTTTTGSQSGETLDLATVMKASQAISGEIVL
DKLLSSLMKILIENTGAQTGFLLLEKAGQWVIEASGTVNSDNVPVFQSLSIDNHLPTSII
NYVVRMKEIVVFNDAASEIQNPPPNSPLGKGGTKIPNLNDPYIKAHQTKSLLCTPLINQG
QLRGIVYLENNLTIGAFTPERLEILQLLSGQAAIAITNAKLYAEVHASERRLTQFLEAIP
VGIGVLDASGKPYYANRTAIELLGKGVVPSATAEQLGEVYQVYIAGTDQQYPSEQMSIVR
ALRGECATIDDVEIHHPDRVIPIESRGTPIFDEKGNVAYAIGAFQDITDRKQAQKLLTDY
NHILEAQVAERTEALHQQAQELKLTLERLQRTQSQLIQAEKMSSLGQMVAGIAHEINNPT
SFIYGNISPATGYAQDLLHLIALYQQYYPEPVAEIAAQIDAIEPNFIAEDFPKLLASIRQ
GAERIMQIVLSLRNFSRLDERECKRVDIHQGIDNTLVILQHRLKQQPNRPEIQVIKEYSE
LPNVECYAAQLNQVFMNILNNAIDALENVRSSSYSLAQEASYIVHSKVAELGRSNEQSTM
NYEQSPTIWISTEVVEQNRVVIRIANNGSAIDPALHSKIFDPFFTTKPVGSGTGLGLSIS
YQIVVERHGGELTCHSTPEQITEFAIALPITQGKKSM
Download sequence
Identical sequences K9WJT6
gi|428312463|ref|YP_007123440.1| WP_015184170.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]