SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312486|ref|YP_007123463.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312486|ref|YP_007123463.1|
Domain Number 1 Region: 778-950
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-63
Family GAF domain 0.0000977
Further Details:      
 
Domain Number 2 Region: 1224-1316,1372-1444
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.47e-45
Family Histidine kinase 0.00048
Further Details:      
 
Domain Number 3 Region: 971-1143
Classification Level Classification E-value
Superfamily GAF domain-like 4.8e-33
Family GAF domain 0.003
Further Details:      
 
Domain Number 4 Region: 1611-1682,1733-1780
Classification Level Classification E-value
Superfamily CheY-like 7.96e-33
Family CheY-related 0.015
Further Details:      
 
Domain Number 5 Region: 1463-1585
Classification Level Classification E-value
Superfamily CheY-like 3.98e-28
Family CheY-related 0.0065
Further Details:      
 
Domain Number 6 Region: 1156-1236
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.34e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 7 Region: 1822-1940
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.49e-19
Family Chemotaxis protein CheA P1 domain 0.029
Further Details:      
 
Domain Number 8 Region: 638-768
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.71e-19
Family Flavin-binding PAS domain 0.079
Further Details:      
 
Domain Number 9 Region: 106-232
Classification Level Classification E-value
Superfamily CBS-domain pair 1.25e-17
Family CBS-domain pair 0.0028
Further Details:      
 
Domain Number 10 Region: 412-521
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000279
Family Flavin-binding PAS domain 0.021
Further Details:      
 
Domain Number 11 Region: 518-639
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000356
Family Heme-binding PAS domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|428312486|ref|YP_007123463.1|
Domain Number - Region: 240-301
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00108
Family CBS-domain pair 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312486|ref|YP_007123463.1|
Sequence length 1949
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MQTETAQTTLPTLEHLIDPHPLTTPPETPLINIIALMGQGRRTHSLPGIATIAPATSVLV
IEGDRTLTSVAPLGSKPIGKANRLVGILTAQDLVRLTASQVNLREIKIADVMTPSVVTLT
LSDSCNLFTVISLFHQHQISHLPVLDPQGQLMGMITVDSLCRGLPDLNLLKWQRVSAAMT
STVIQAPLSTSVLSLAHLMSQERESYVVLTEQGLNVSSLPVGIVTERDIVQLVQLSLMGL
DLSQTQAHLVMKTPLLGLSPEDSLWTAHQQMQQWQLQHGLVYGEREDWRGVFTQKELLRS
LDPMQMLGVIDTLHQTVEQQAEELQRAHERLSAPRFYPPSVEQNQAESSNNQTHSPKPFE
GNPNPSNSELPLSSPTPEASAPEAPPNQETCCHGSLDELKKTQERLELVTYAANDGLWDW
NLQTGEIYYSPRWKEMLGDLDYEQPSDLLAWEQVIVDVDPISSLKLMKDFQGGHASRFIV
TQRFRHKDGSLLYILSQATHLKDDQGRVVRMVGTHTDVSELITAQEALRQGEERLRALLN
AIPDLMFRQRVDGTYLDFKLKDGNLLVPSETPSQCHFWDVAIPEAVKQRHLKLLQVAVAT
GELQTYELELDKPDRVRNYEVRIVKSGTDEAVCIVRDITDRKRTEEGLRENEQFLRSIYD
GVEKSIFVVDVLENGEFRYVGLNPAHEYLTGIPSEQLCGKTPEQVLPLESAMAVRDRYQS
CVEEGTTISYEECLPFNGIETWWITSLTPLLDTHSRIYRLIGTSTDITERKRAEIALQQQ
AERERLVSEIARRIRQSLELEEILHTTATQVRQFLQTDRVIVYRFNPDWSGVVAVESVGQ
GWKAVLGSTIYDPCFSKDYTHLYQQGRIGIVEDVYNAGLTPCYVDFLAQLQVSASLTVPI
LQGDRLWGLLIAHHCHGIRKWQSLEVELLQQLATQVAIAVQQSELYQQVQAELAERKRVE
EGLREHKAALQRQVHRALLLKQITQEIRQSLDTHRIFNTTVAQIGQAFRVNRCVIHTYIA
KPTPQVPFVTEYLEPGYESILDLTVPVRGNPHMQRLLVQDSAIASPNIYTDPLLQAAIPL
CQQIGLKSMLAIRTSYQGEPNGVICLHQCDSLRDWTSDEIELLEAVADQVGIALAQARLL
EQEKRQREQLAEQNIALETSKQAAEAANRAKSEFLATMSHEIRTPMNAVIGMTGLLLDTE
VTPQQHQFVETIRNSGEALLTIINDILDFSKIESGKLELEEQPFKLRMCIEESLDLLAPK
AAEKELELAYLIDSQTPVTIAGDVTRLRQILVNLLSNAVKFTRSGEVTVSVTAKGVPVKH
EVGRESVGNNPGFSISPSPNTQPQLDKPCDPGTRQDTLSSVSVHPVPYPYYEIQFAVKDT
GIGIPTERLDRLFQPFSQVDSSTSRHYGGTGLGLVISKRLCEMMGGRIWVESEVGKGSIF
YFTVIAHAVYSSTPTDLDVAQPQLEGKRLLIVDDNATNRKILTLQGKSWGMLTRAAHSGR
EALDWLSQGELFDLAILDMQMPGMDGLTLATEIRKKPGYQELPLVMLTSIGKPESSDPSQ
MSHFAAFLNKPIKQSQLYESLNQVLLGQPIKVRPLCSLYPEIDSNLAHKLPLKILLAEDN
VVNQQVALHLLQRLGYRADVVGNGLEVLEAVHRQSYDVVLMDVQMPEMDGLTAAHRISQE
SSFAWELEAAGENLITAFPGVSLTETHQQSNSPTSTNRPPEKVPGQPNSKSNKRPRIIAM
TANAMQGDREMCLEAGMDDYISKPIRMKELVRALSKCQEELKVSPLNVEHSEGKIQPSNR
KSIPTENATRANLIQPATAHSSEALIDVAAFQELREMVNHDGILESVIDSYIEETPKLLQ
AMQTALAHLHRVEADQNEALVLQRAAHTLKSTSATLGAIYLAQICGVLEALKPMGKLVEA
TALVSQIETEYEKVKAALLEKIRHLNSIG
Download sequence
Identical sequences K9WKM9
gi|428312486|ref|YP_007123463.1| WP_015184193.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]