SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312511|ref|YP_007123488.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312511|ref|YP_007123488.1|
Domain Number 1 Region: 11-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.53e-131
Family Cystathionine synthase-like 0.000000000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312511|ref|YP_007123488.1|
Sequence length 420
Comment cysteine desulfurase-like protein, SufS subfamily [Microcoleus sp. PCC 7113]
Sequence
MTFTKQRTIADAVRSDFPILHQEVNEKPLVYLDNAATSQKPLAVLDALRHYYERDNANVH
RGAHSLSVRATEAYEGARDKVASFVNAASRQEIVFTRNASEAINLVAYSWGLNTLKPGDE
IILSVMEHHSNIIPWQLMAQRTGAVIKYVGLTKTQEFDLEQFQQLISDKTQLVSVVHVSN
TLGCINPVEEIIAIAHRYGAKVLIDACQSVPHMPIDVQAMDCDWLVASGHKMCAPTGIGF
LYGKLDLLEAMPPFMGGGEMISEVYLDHSTYAELPHKFEAGTPAIGEAIALGAAVDYLMG
IGMDKIHAYEEELTAYLFEKLRGIPDLKVYGPQPTANGKGRAALASFTVEGLDSSDVSAL
LDQEGVAIRSGHHCTQPLHRILGVAGTARASLYFYNTREDIDAFINGMKETMDFFGSILG
Download sequence
Identical sequences K9WKR0
WP_015184218.1.75295 gi|428312511|ref|YP_007123488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]