SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312588|ref|YP_007123565.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312588|ref|YP_007123565.1|
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-61
Family Protein kinases, catalytic subunit 0.0000701
Further Details:      
 
Domain Number 2 Region: 1809-1993
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-32
Family Histidine kinase 0.0031
Further Details:      
 
Domain Number 3 Region: 1375-1552
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-26
Family GAF domain 0.005
Further Details:      
 
Domain Number 4 Region: 290-598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.95e-18
Family Extended AAA-ATPase domain 0.084
Further Details:      
 
Domain Number 5 Region: 1536-1664
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000059
Family Flavin-binding PAS domain 0.083
Further Details:      
 
Domain Number 6 Region: 1721-1817
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000628
Family Homodimeric domain of signal transducing histidine kinase 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312588|ref|YP_007123565.1|
Sequence length 1997
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNILAQYQIISTLHEGVETIIYRGQIPSHPESRILKLLKAKYPSLEAITHLKHEYQIRQN
LEHSNIVKALSLETFNHRLALLLEDFGGHSLDQHLQTEKLSITTCLRIAIQLTQALDYLH
QNQIIHKDIKPSNIIINFPSEIVKLNDFGIASRLSKENPIFNNPNSFEGTLAYMSPEQTG
RMNRTLDYRTDFYSLGVTLYEMLTGQLPFQSHDLLEIVYSHIAQSPTPVQQLNPEIPSAI
SAIVMKLMAKNAEDRYQSAAGLLADLEFCLNSFNNPIEITNFSPGRLDILSQLLIPQKLY
GRETQVTQLLAAFERVSGGETQDKKPFQTELMLVRGYSGIGKSAVVNEVNKPITRQRGYF
IAGKFDQFKRNIPYASLTQAIGSLMRQLLTENNAKLQDWRNKILTAIGSNGQVIIDVIPE
VELIIGKQPEVPQLEPIASQNRFNRVFKRFIQVFTQKQHPLVIFLDDLQWADSATLKLMQ
LLATDSDHKYLLLIGAYRDNEVSPTHPLIQIVEEIQQAGAVVNNIVLQPLELADVTQLIT
DTCNNCIEENAELNGLFHPQNEKTKELAELICNITKGNPFFLTQLLQTIYQENLLRFDFS
TASWQWNLEEIQAICIADQTVVELVTRRIQKLPEATVKVLKLAACVGDKFTLDVLSIVSE
QSPITTAIALYPALQAGLILPLSEAYKIPLVFEEIEVEPNETGSEFLSEREDDKLSKIQN
LKSTIAGVGYKFLHDRVQQAAYSLIPESSKRETHLKIGKLLLESIPESEIEENIFEVVNQ
LNIGIELIAEPTEKVKLAQLNLIAAVKAKAATAYEPSLKYLKIGLGLISADSWIHQYDLT
LNLYIEAVEVEYLNTNYQQSKALIDIALKQAKTVLDQVKIYEKKIKFYTSQGNFIAAIDT
GLEILDLLGNPLPKDSAGIEQISEHLRSQLRFEVNQIAKLADLPKMNDAVKLAATHILAT
LIPPVYFAQPALLFPVILSLVHLSVQYGNAASSAYGYCLYGLLLCGALDDIEAGYEFGRL
SLNVLEQFASDPIKCQVHKVFASHIQPWKEPLREAMKNFITAIQTGLETGNAEYMGYGSA
EYCMYLFFSGENLAVVAQKTEPYEELLEKLKQEFGIFYLKVGRQVALNLAGKAESPCLLT
GADFQEETMFLRLEEANYRMIIFCFHLFKLILLYNFKDYTNALIHAEHAVSYLDAVVGTI
YVAEHNFYHSLILLKISSSLSPRKRKKYLLQVQFNQEKMKQWAFYAPMNFQHKYDLVEAE
KAHVLKRPLAAMDYYDCAIQGAKKQGYIQEEALANELAAEFYLACGREKVTQTYMLEAYY
GYFTWGAIAKVKDLESRYPFLKTQTYKPEIPQLKVTHTTTESTSTGHFSNFLDLASFIKL
SQVITSEIVLEKLLNKLIKILLENAAAQKAVLLLLKDEQLYIEATGKTTDEVVTILQSIP
VETSQDLPLSVVNYVLRSQKNLVLNDATIAEPFNADSYIQNSQPKSILCLPIVYQSKLQG
IIYLENNLAVAAFTQERVKVLEVLVSQVAIAIVNAQLYAQVRESESRMRQFLNAMPAGVF
VTNRQGQPYYTNQIGQQILGQGVVDTLTAEQLPEVYQAYLAGTNQFYPSTREPIAQALQG
KTVKIDDMEIRHSDKSIPIEVLGTPIYDEEGNIAYAIAAFTDITERKQAEAEREKFLNEL
SHLNHDLEQANQQLEEYSHTLEAKVEQRTAALKAAQKQIIAKEKLSSLGALTAGVAHEIR
NPLNFVNNYAEGSVELTEELLAEMDNQTEHLDADTLDYMKQMLIDIRDNAAAIHQHGQRA
EGIIHSMMQHARMDSGQHQPTDLNSLLDQAVQLAYHSKRAINSQFNVVICKDYDDSIGQW
EVVSGDLNRAFINMIDNACYAVQAKQKHYQQQQENNQQGHLSHEEEVFTPTIWVKTQHLG
EAVEIRIRDNGMGIPPELTEKIFNPFFTTKPTGEGTGLGLSLTHEIIVGQHGGTLKVETE
PGAYTEFIITLPRCLSV
Download sequence
Identical sequences K9WK65
WP_015184295.1.75295 gi|428312588|ref|YP_007123565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]