SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312618|ref|YP_007123595.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312618|ref|YP_007123595.1|
Domain Number 1 Region: 137-317
Classification Level Classification E-value
Superfamily GAF domain-like 9.32e-63
Family GAF domain 0.000000171
Further Details:      
 
Domain Number 2 Region: 328-515
Classification Level Classification E-value
Superfamily GAF domain-like 4.41e-61
Family Phytochrome-specific domain 0.000000823
Further Details:      
 
Domain Number 3 Region: 609-747
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-40
Family Histidine kinase 0.00024
Further Details:      
 
Domain Number 4 Region: 8-129
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.59e-34
Family BphP N-terminal domain-like 0.0000677
Further Details:      
 
Domain Number 5 Region: 513-595
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000471
Family Homodimeric domain of signal transducing histidine kinase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312618|ref|YP_007123595.1|
Sequence length 769
Comment bacteriophytochrome (light-regulated signal transduction histidine kinase) [Microcoleus sp. PCC 7113]
Sequence
MTGINLETQEVNLNRLKQPPIHLLTQVQPHGVLLVLQEPELTVLQVSRNTFQALGLAPEA
ILGKTLDDILDSFQVDRVRMGLSHENLDLINPTKVWVRRKGDDYQVFDAVFHRSADGFLV
LELEPALTQETIPFLSFYHLARASINQLETTSNLQDFCQIIVREVRKVTGFDRVMLYKFD
EDGHGEVVAEAKLDEMEPYLGLHYPESDIPQPARKMFLSNWIRVIPNAHAEPVELYPGDN
PITNQPVDLTLSILRSAYPCHLEYLHNMGVGASLTISLMKDEKLWGLIACHHRTPKHVPY
ELRKACEFLGRVIFAEIFTREEEADYNYRMKLAQVQSALIEYMSQADNFIDGLIQQEPNL
LDLADAKGAAICFNGHWTTIGRTPPEEELNYLAQWLTKTVDEEVFYTDSLPLIYSDAERF
KDVASGMLAIPISKRSYVLWFRPEVIQTVNWGGDPNHAYELKESSDTLQLCPRKSFDLWK
ETVRLKSLPWKPIEVKATLELRKAIVNIVLRQAEELALLAQDLERSNAELKKFAYVASHD
LQEPLNQVANFVQLLEMRYNDELDEDGKEFIGFAVDGVSLMQTLIDDVLVYSKVDLKGIE
WELTEVETSLNRAFSHLRGRITETQAEITYDSMPIIVADSTQLMQLFQNLLGNAIKFKKK
DEAPRIHVGVQRQEDSWLFSVQDNGIGIDPQFADRIFVIFQRLHTRDEYPGSGMGLAICK
KIVECHRGRIWVESELGKGATFFFTIPVGGRDRHHASGHKKQNYPFGRR
Download sequence
Identical sequences K9WK92
gi|428312618|ref|YP_007123595.1| WP_015184325.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]