SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312654|ref|YP_007123631.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312654|ref|YP_007123631.1|
Domain Number 1 Region: 455-570
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-36
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 3-170
Classification Level Classification E-value
Superfamily CheY-like 6.69e-36
Family CheY-related 0.0009
Further Details:      
 
Domain Number 3 Region: 142-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.54e-19
Family Flavin-binding PAS domain 0.044
Further Details:      
 
Domain Number 4 Region: 276-359
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.14e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312654|ref|YP_007123631.1|
Sequence length 576
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSAKILVVDDESAMESLIRQKFRRQIRDKNLDFIFAYNGREALEKLQSDQSVDVVLVDIN
MPEMDGLTFIERLKDLEPNIKAVVVSAYDDVTNIRSAMNRGAFDFITKPIDFNDLEITIN
KSLEHVREIKEKQQKLQQAQNQLLQSNQALRESEQRFRQLAENIKEVFWVTSVDRTQVIY
VSPGYELVWHSSSKQLYEQPMSWVDAVHPEDRERVCTTIETRQGEEYEQEYRIMGPDRSI
YWIRDRAFPVKNEMGQVYRLVGLSEDITVRKLAEEEICKALQRERELSELKTSFVAMTSH
EFRTPLTTIQSSVELLEHYSHNLSEEKQQIHLHRISRSVERMVEMLNDILLISESEAGQL
KFNPTPIDLVKFCQRVVEELGHNDQRQPARSNPISVCHRKSSIPDASLTANLPVHHLNAN
EGAPSEQVQTLEHASAFFLGVGRIAFKLRGALPTHDGLALMDAKLLLQILTNLLLNALKY
SAADSTVQFDLIYLDHKAVFRIQDQGIGIPTADQCHLFESFFRASNIGTIQGTGLGLAIV
KQCVDLHQGEITVDSVEGMGTTFTVTLPLEWYTSTH
Download sequence
Identical sequences K9WII7
WP_015184361.1.75295 gi|428312654|ref|YP_007123631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]