SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312656|ref|YP_007123633.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312656|ref|YP_007123633.1|
Domain Number 1 Region: 1095-1194
Classification Level Classification E-value
Superfamily Cadherin-like 1.55e-27
Family Dystroglycan, N-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 1247-1422
Classification Level Classification E-value
Superfamily beta-Roll 4.19e-27
Family Serralysin-like metalloprotease, C-terminal domain 0.00056
Further Details:      
 
Domain Number 3 Region: 686-1056
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 1.06e-18
Family DPP6 N-terminal domain-like 0.017
Further Details:      
 
Domain Number 4 Region: 213-482
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 1.06e-16
Family DPP6 N-terminal domain-like 0.049
Further Details:      
 
Domain Number 5 Region: 497-768
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 5.89e-16
Family Tricorn protease N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312656|ref|YP_007123633.1|
Sequence length 1431
Comment Ig domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MTATLHRTQFASQSLSISASATREIVFIDSAVTDYPDLVAGVRSRVEVIVLDAMRDGVEQ
ISEVLAQRKDLTAVHLVSHGSPGRVQLGAIELSLETINRDAWQLQAWAEALTDAAELLIY
GCEVAKGDRGRVFVNMLHTIIGANVAASAVITGCAAQGGNWALETTTALSAASLAFTSTV
LEQYAATLSNEPIQYNINLATDSSNPSNFTDVNGTLYFSAYNDSNGYELWKIDPATGNPV
RLEIEPGSGSSNPYNLTNVNGTLYFSAYNTSNGSELWKIDPATGNPVRLEIEAGSGSSTP
YNLTNVNGTLYFSATNSSNGRELWKIDPATGNPVRLEIEPGTGSSTPYNLTNINGTLYFI
ATNSSNGYQLWKIDPASGNPVPLEIEAGSGNSSPDYLTNVNGTLYFRFGNFAFGYQLWKI
DPATGNPVRVTDIEPGNGSFFPDNLTNVNGTLYFRATNSSNGSEVWKIDPSTGNPVRLTD
IEPGSGSSFANNLTNVNGTLYFSATNTSNGTELWKIDPITGNPVRLEIEPGSGSSNPFEL
TNVNGTLYFRASNTSNGNELWKIDPATGNPVRVTDIEPGSGSSFPQDLMNVNGTLYFRAT
NTSNGEELWKIDPITGNPVRLEIEPGSGSSSPFKLTNVNGTLYFRAYNTSIGFEVWKIDP
ATGNLSSIDVNTQDFGSNPSNLTNVNGTLYLSATNGSNGTELWMIDPTTGNPVRVTNIEP
GSGSSSPSNLTNVNGTLYFSAYNQSNGDELWKIDPATDNPVRVTDIEPGSGSSSPYKLTN
VNGTLYFRAYNQSNGDELWKIDQATDEPVRLEIEPGSGSSNPFYLTNVNGTLYFLAYNTS
NGGELWKIDPATGNPVRVTDIEPGSGSSSPDNLTNVNGTLYFRTGNFVFGYQVWKIDPAT
DNPVRVIDVGASSGIFSPDKLTNVNGTLYFTADNGSNGNELWKIDPATGNPVRLTDIEPG
SGGSFPEKLTNVNGTLYFSAADGSNGRQLWKIDSATGNAVRLTDMEPGSGGGSFPEYLTN
ANGTLYFTAYNSSNGRELWRINPNTNTPELVADFNPGTASSNVAILGYENGKLYLRADNG
INGAELWTLDVSNNAPVVTNAIADQSATEDTAFIFTIPANTFSDVDGDTLTYSATLADGS
ALPSWLSFDATTKTFSGTPENGDVASLNIKVIAANSSGATAEDIFILAIANTNDNPDAVD
DILTARQCTPKTILAAELLANDTDVEGNTLSLTHVSNAQNGTVALDSNGNVVFTANANVS
TASFEYTLSDGNGGTDSAIVTLLVGTTLNGGNGKDTLTGTAGDDVLNGGNRNDILLGLAG
DDILLGGNGMDKLQGGEGKDRLYGGRGNDLLTGGLGSNIFVLMTQSGRDTIQDFTDGEDK
IGKIGGLTFEQLTIGSSNDNTLISKNCGEVLAILADVNSSLITQADFISVM
Download sequence
Identical sequences K9WL23
gi|428312656|ref|YP_007123633.1| WP_015184363.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]