SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312687|ref|YP_007123664.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312687|ref|YP_007123664.1|
Domain Number 1 Region: 442-623
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.77e-38
Family Histidine kinase 0.0041
Further Details:      
 
Domain Number 2 Region: 161-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-26
Family Flavin-binding PAS domain 0.042
Further Details:      
 
Domain Number 3 Region: 31-139
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.21e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.028
Further Details:      
 
Domain Number 4 Region: 348-384
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000863
Family Homodimeric domain of signal transducing histidine kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312687|ref|YP_007123664.1|
Sequence length 636
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MATQTALTLCTQSNGREAEPKHFVCGSLDKLFTLTLDMFFIVGFDGYFKQLNSICEKTLG
YTTEEFLSQRWIELIHPEDQPAMLERLQELTTEARTVQFENRYRCQDGSYKWLLWNVAAC
QDEQLIYAVARDNTECRRAEAAQRESEEHFRLLVEGVKDYAIIMLNPAGRIVSWNTGAER
IQQYQASEILGKHISCFYTEKDIELGRPLHGLEIAALQGRFEDEGWRIRKDGSKFWANVV
ITALRDEDGRLSGFVRVTRDITERKLAEQELQQAHDELEKRVAQRTAELTRTNELLKQEI
AEHERTEAALRQSKARLKQQAQQLEAEKQHATSLLGKLQRTQAQLIHTEKMTTLGQVISG
IAHEINNPVGFIYGNLDYASCYINDLMRLVELYFQHYPQPAPAIEAELDAIDLNFLMADM
PKLLSSMKVGATRLRQLVLSLQNFLRTEQTEMKPVDLHEGLDSTLMILRHRLKASEEYPE
ITVNKEYGTLPFVECFAGQMNQVFMHLITNAIDVLQASVEPGKPNYQITITTGVQDMKAA
LLEGKTPEKIPHAVIRISDNGPGMSEDISCRLFEPFFTTKPPGKGTGLGLSISYQIVVDH
HGGQLTCVSEPGKGAEFVIYLPVRQVALSASLSQCA
Download sequence
Identical sequences K9WJ93
gi|428312687|ref|YP_007123664.1| WP_015184394.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]