SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312706|ref|YP_007123683.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312706|ref|YP_007123683.1|
Domain Number 1 Region: 1021-1218
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.55e-40
Family Histidine kinase 0.0053
Further Details:      
 
Domain Number 2 Region: 717-890
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-31
Family GAF domain 0.0056
Further Details:      
 
Domain Number 3 Region: 461-586
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-23
Family Heme-binding PAS domain 0.03
Further Details:      
 
Domain Number 4 Region: 337-462
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.81e-21
Family Heme-binding PAS domain 0.071
Further Details:      
 
Domain Number 5 Region: 157-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.071
Further Details:      
 
Domain Number 6 Region: 607-718
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.76e-17
Family Heme-binding PAS domain 0.052
Further Details:      
 
Domain Number 7 Region: 16-126
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000038
Family Heme-binding PAS domain 0.079
Further Details:      
 
Domain Number 8 Region: 933-974,1004-1036
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000129
Family Homodimeric domain of signal transducing histidine kinase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312706|ref|YP_007123683.1|
Sequence length 1221
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MQYLDKSDTRLKLALQATKSGMWEWNLLTGQVTWSENFEALWGLAPGTLKGTYKSLLKQI
CVQDRRFVRRVLTRAIRKKTNYRIEFSINCPDGSRRWLRSEGEVYSDGHPIKVSGLCQDI
TSDKQAEGVERQPQADQPENQEIETSLNTCEQRLNHILNSLEDVAWSATLDRFELIYLNP
AAESIYGRPSHEFFQNISLWLEIIHPEDRPHVWTQRQKVLELGGGDMEYRIVRPSGEIRW
LRDRLQVIYDRAGQPTRLDGVATDITRQERVIAALQQTNEALEVRLKERTAALEPILEQL
HSLSANSPHLSSGSMPHNPENGEMEYVTVARNLALTKQAEAVIERSKAKWRSLIQYSCDL
ITVVSASGTILYNSPALERILGYSPEELVGQHGLRYIAPEDVAALKVAWKQLRIAAHGST
LSPTTFRALRKDGSWCRLEVTATNLLADEAVEGIAVSARDVTERFRLQELRQPSEAHFRA
IFENAALGIALSDPSGEIIASNQALHQMFGYSEQELRQVTITHPDDTAADFTLYQELLAG
SIPSYQMEKRYFHKQGYLVWGRLSVSLVRDPSGSLLFVVSMVEDITAAKRTEAALLHISK
AVENASDAIAIADTLLVRFNYLNPAFYQMFGYTLEQLNEAGGFTMLFPDAKIMPDVLASA
VSGQSWQGEVEMVSRNHSRRQIALRIDAIKDVTGEVVGTIAIHTDITERKQAEAALRRSY
ERAELLKQITSEIRSSLDPQHIFQTTVTQLGEALLVNRCMIFLYQSAPQSTLSLVAEYLE
TGYSSIGAFEVPVEGNAHIQQVLATDRAIASTNVYAEPLFADTLPLCRAMDIQSMLAIRT
SYQGQPNGVLGLHQCDAYRYWTSSDIELLEAVAAQVGIALAHARLLEKEQCTAAQLAQQN
LDLQISNSRANTKAAELEQALQNLQETQAQLVQTEKMSSLGQLLAGVAHEINNPVSFITV
NINYACDYIQDLLRIVHLYQDYYPQPFEEIKYELQEIDLDFIIKDLPKLLNSMKVGAERI
NQIVLSLRNFSRQDEDEMSSVDIHEGIDHTLMILRHRLKAKGGSPEIEVSKNYGKLPQVV
CYAGQLNQVFMNLISNAIDAIVSRFAHDHDALVIHTGGEGEIERISPPNYETTPKIKICT
ETRDNHWVIIRIKDNGPGMTEEVKQKLFNPFFTTKPAGKGTGLGLSISYQIVVEKHGGHL
QCISVPGQGTEFMIELPIHHS
Download sequence
Identical sequences K9WL70
WP_015184413.1.75295 gi|428312706|ref|YP_007123683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]