SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312871|ref|YP_007123848.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312871|ref|YP_007123848.1|
Domain Number 1 Region: 942-1087
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.99e-39
Family Histidine kinase 0.0009
Further Details:      
 
Domain Number 2 Region: 561-733
Classification Level Classification E-value
Superfamily GAF domain-like 1.98e-23
Family GAF domain 0.0067
Further Details:      
 
Domain Number 3 Region: 433-564
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000105
Family PYP-like 0.034
Further Details:      
 
Domain Number 4 Region: 373-423
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000405
Family HAMP domain 0.0058
Further Details:      
 
Domain Number 5 Region: 775-810
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000186
Family Homodimeric domain of signal transducing histidine kinase 0.0064
Further Details:      
 
Domain Number 6 Region: 168-235
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000647
Family Sensory domain of two-component sensor kinase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312871|ref|YP_007123848.1|
Sequence length 1088
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MIIQHLDRSVTKVFGKVPLRTVLIVPFTLQLFTAVGLVGYLSFRQGQKAVNEVTRQLGRE
ISIRIEQDLSTYLNIPHQINQSNADAIRLGELNVKDFSQLQGHFWQQKQRFKNISSIAFS
NEQKERIGIGELDNGSLAIGESNKLTGYDFHLYGINSQGQRLKLLNVIKNYDPRIRPFYQ
AAVANNSQKWSKVFTLFNTSSLVISAVQPVYDNKGKVEGVLYSSLSLSEISEFLHRLKIG
KNGQSFIIDREGILVATSTTEEPFRIVNNLKKRLRNTDSSDPLTQATSKYLESHFSSLTQ
IKNSQQLEFKINGKRQLVQVLPFQDGKGLDWLIVVVVPEADFMGHINTNTNITILLCIAA
LIVAIAVGLLTARWVVQPICGLNTRALALAKGEWDKTEEIERFDELGELAKSFNNMAYQL
QESFTTLEANNVQMKALNQALSESESRLAQFLEAVPVGIFVSDASGKPYYVNQTGQQILG
KGIVESATTEQLQEVYQLYLCGTEQLYPSDRLPIVKALQGESVWVDNLEIHRPDKIIPIE
TLGKPIYDESGNIAYAIAAFTDITERKQAQEDLAERAKIAELGADVALALTQETTLETIL
HRFTNAMVERLEAAFARIWLLNEVDNILELQASSGLYTRLDGQYSRIPLDQLKLGLIAQE
KQPYLTNDVLNEPRIRDKEWAKKEGLVAFAGYPLLVGNKVVGVMAMFARKPLSDVRLQGL
ALIAHTIALAIERKRAEKLLAEYNRTLEAQVEERTQELSQTLEHLQATQQELIQSEKMAA
LGQLVAGIAHEINTPLGAIQASIGNISTALDNSLRQLPELLQQLSPQQQIDFLALLAAAR
QNSQLLSFKEERQFKRSIKKELEAQGIAKAETLATNLVQMGITQNLAPFIPLLQSPNNTL
ILEAASNLSVQHNNTQNIKLAVERASKIVFALKSYARQDQSGQMTRSQLIQGLDVVLTLY
HNQLKQGIEVIKKYEDVPAILCYPEELNQVWTNLIHNAIQAMNYKGGLEIAVSQQDNQLV
VQVTDSGCGIPSEIKSRIFEPFFTTKPAGEGSGLGLDIVHKIIDKHQGKIEVESQPGRTT
FSVWLPIR
Download sequence
Identical sequences K9WLM4
WP_015184577.1.75295 gi|428312871|ref|YP_007123848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]