SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312874|ref|YP_007123851.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312874|ref|YP_007123851.1|
Domain Number 1 Region: 10-147
Classification Level Classification E-value
Superfamily CheY-like 3.13e-39
Family CheY-related 0.00044
Further Details:      
 
Domain Number 2 Region: 306-435
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000119
Family Flavin-binding PAS domain 0.071
Further Details:      
 
Domain Number 3 Region: 159-317
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000135
Family GAF domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312874|ref|YP_007123851.1|
Sequence length 476
Comment response regulator containing a CheY-like receiver domain and a GGDEF domain [Microcoleus sp. PCC 7113]
Sequence
MNNPSILDAKSDILVVDDTRENLLLLATMLSESGYKVRKAINGTLALGAVEIAKPDLILL
DINMPNINGYEVCQRLKADQQTSDIPIIFISALDEVLDKVKAFEVGGIDYITKPFKMQEI
LVRIKTHLTISLQQKQLTKQNAWLQLLLTTTKAIGEAGDFHAALEVTLTQVCEKIGWDFG
ECWLPNSQATVFELGTGWYASDQRFEEFRHKSKPMTFATNREFLRQICLKQQSCWLTDVS
VEPGDVFQRNQLAGEVGLKACWGVPILCANQVLAVLMFLKQEASEPELQLFDLVNSLAIQ
LSSLIERKRSESALHETQQQFEAMTANIPGCVYRGVVHTNGRMKLLYASQGEYELSGLHP
QEAMAQQEPLESLPADRQADFYEALKAAAQAHKPITQEYPIASATGEMKWVRNSARYTLM
DNGDVIVDGVAIDVSDCLRNSFTSGVAAEERLRHLEHAIAHSAPTKPNTASRTGIN
Download sequence
Identical sequences K9WJ61
WP_015184580.1.75295 gi|428312874|ref|YP_007123851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]