SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312934|ref|YP_007123911.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312934|ref|YP_007123911.1|
Domain Number 1 Region: 353-445,473-546
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.45e-34
Family Histidine kinase 0.0055
Further Details:      
 
Domain Number 2 Region: 15-139
Classification Level Classification E-value
Superfamily CheY-like 1.99e-32
Family CheY-related 0.0018
Further Details:      
 
Domain Number 3 Region: 132-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-19
Family Heme-binding PAS domain 0.044
Further Details:      
 
Domain Number 4 Region: 272-364
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000863
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312934|ref|YP_007123911.1|
Sequence length 559
Comment PAS/PAC sensor hybrid histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MMLNRNPPKINSYKTVKILVVEDEKIIALNVRESLESLGYIVPAIADSGEKAIEKATQLR
PDLVLMDIRLKGNMDGIQAAEQIWNSMQIPVIYVTGHSDKSTLERAKITVPFGYILKPVK
EQELYVAIETALQRYEREQLLSAILKGMGDGVILVNPQGRVQFLNQVAESLTGWRQDEAR
DREFIEVFKIVSEQTQQPVNNPVTAALQQDTTVYLEDRVLLLSKNGTPIPIGDSAAPVKD
NKGVITGVVLVFRDITQRRLAEERNLAMERARYLELQIAELQRLNQLKDDFLSTVSHELR
TPLSNIKMAVRLLETVLDQQSILGSQTHFNSQSMNRYLKILEDQCNQELMLVNDLLDMRA
IDADAYPLELTSIELQNWIPHIVESFEARTQTQQQNLQVSLPPELPPLVSDLSSLTRILS
ELLNNACKYTPAGEQIVVTVQVISEDKENQGDKTVESLPSSPLTPALRCPPRGVQIDVSN
SGVEIPTEELARIFDPFYRIPKNDPWKYGGTGLGLSLVKKLLVRLQGNLDVTSTQGWTTF
RLFLPNLELPFQEVDCDFD
Download sequence
Identical sequences K9WJC1
gi|428312934|ref|YP_007123911.1| WP_015184640.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]