SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312969|ref|YP_007123946.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312969|ref|YP_007123946.1|
Domain Number 1 Region: 40-186
Classification Level Classification E-value
Superfamily GAF domain-like 5.02e-21
Family GAF domain 0.02
Further Details:      
 
Domain Number 2 Region: 231-300
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000412
Family Homodimeric domain of signal transducing histidine kinase 0.0022
Further Details:      
 
Domain Number 3 Region: 290-388
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000164
Family Histidine kinase 0.021
Further Details:      
 
Domain Number 4 Region: 478-514
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000258
Family Histidine kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312969|ref|YP_007123946.1|
Sequence length 520
Comment histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MTNPEPRIFCRLDGLTPAAREQKRLTALIELGLLETETVTVFEEAAQTAARLIDAPIGIL
GVMGQNDLHIKAAVGLSRVGLMNQLAKSRLLPRSESFCTYVVDSHQVLAIYDTAIHPIFA
SSLLVGHYGIRAYLGAPLLTADGLCLGTLAVMDWEPRSFSAKEIELLAITARWSLSEFER
NRFLQQEYSSSIQKIPLSSTISQYRGGWGGESTTDRQDVSQDFSAGLNSGNSIKLQLLAQ
LTQELRTPLTSVMGMASVLTRQVYGPLTSKQKEYLEIIHRSGQQLISLVDEIVDLKILDD
GSEQLQLTSVDIEMLCQQAINSLLEIAQRQQLEIRLSVEPGNRIGLLDKDKVRQILYYLI
YSVIQSAEAGSEVRLHASRKTDTINMAVWVSHPWLGDGLPQFGEGVVESYLPSSAIAAVS
TALETSPDNSEMESSELIAMCYLSPTAPVLSSALLPVPLSLNSKPNKTPEKPESRESLGL
LLSSHLAELHGGEISVQGSTEAGYRYVVTLPLFESEKERL
Download sequence
Identical sequences K9WJF9
gi|428312969|ref|YP_007123946.1| WP_015184675.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]