SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312988|ref|YP_007123965.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312988|ref|YP_007123965.1|
Domain Number 1 Region: 802-970
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-48
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 1010-1134
Classification Level Classification E-value
Superfamily CheY-like 9.39e-32
Family CheY-related 0.0034
Further Details:      
 
Domain Number 3 Region: 423-551
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.08e-31
Family Flavin-binding PAS domain 0.085
Further Details:      
 
Domain Number 4 Region: 321-429
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.075
Further Details:      
 
Domain Number 5 Region: 578-730
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-21
Family GAF domain 0.0036
Further Details:      
 
Domain Number 6 Region: 730-813
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.81e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 7 Region: 161-275
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-18
Family Heme-binding PAS domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312988|ref|YP_007123965.1|
Sequence length 1141
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MLNVLSPRLRRYGVAGLVVVLALLLKFLLELQIKVENPFLLFFPAVMFSTWYGGLGAGLL
ATLTTSLLSYYFLVDPNSSLLFSIFGRMALSESTVGQSLRWIPTPEQILQLGLYLLQALL
FSQLSGVLRDRKPQDQLLEKTPSILVHTAPVDQDIDVDAHDISDCKHGEEILRQSEEHLR
LVVQNMPVMMDAFDAQKNIIAWNRECERVTGYSAEEIIGNPHALKLLYPDAAYREWMLAE
HGTRVHNYRNWEWNITCKDGTVKTIAWSNISAEFPIPGWVTWGIGVDVTERKAALSERQQ
TEEALKNSQERLLLAQKAGKIGTFEWNLQTHELIWTQELEALYGLAPGSFGGKYKDWLKT
IHPDDRARAKQEVRCILTQGLDSKMEYRMLWPDGSLHWIASRARVFNDDAGKPRRMIGVN
MDITERKQAEEALKESEMRFRVMFNQAAVGIALVALDGYFIQVNPAMSNITGYSRAELLQ
LTVQEISHPDEQQSDEAYLQRVLEREINGYSVQKRFFCKDGSIVWVNVTVSVVWDSNGSP
KYGIGIIEDISDRKHAEASQQFLLEASRLLAASLDYETTLSNVAHLAIPTLADWCLVDMF
QTDASIRQIAIACTEPSKQATLNELRRRYPPNPKVQNPLWQSLLKGQSIIYPELTESQIV
AMAQDDEHLQLLKSLGRRSVMIVPIQSRQQVLGVISFVSSQSKRRYNPTDLALAEDIARR
AATAIDNARLYRDSEAARNAAQEANRMKDEFLAILSHELRSPLNAILGWTQMLRTRKFGE
EATSRALETIERNARAQTQLIEDLLDVSRIIRGKLNLSIYPLNLASVIEAAINTVRPAAD
AKGIQIEFIATSGIKFISGDAGRLQQVVWNLLSNAIKFTPQGGRVEVRLDSTNTHTEIKV
TDTGKGISPDFLPQVFDRFRQADSTTTRSYGGLGLGLAIVRHLIELHGGTVQAESLGEGQ
GATFTVQLPLVESSKDVPPSDRFSPPDQLTNAPISPELRAVNSTAPTPLRGLRVLVVDDE
ADTRDFLSTVLELYGAQVRIAASVSQAISEIERLPPDVLVSDVGLPGEDGYSLIRKVRAL
KSDRGGLIPAVAVTAYAREEDVKRAIDAGFQRHIPKPVESMQLVAAVARLAGRIEENERS
T
Download sequence
Identical sequences K9WLC4
gi|428312988|ref|YP_007123965.1| WP_015184694.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]