SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313071|ref|YP_007124048.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313071|ref|YP_007124048.1|
Domain Number 1 Region: 1289-1395,1439-1510
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.41e-33
Family Histidine kinase 0.0048
Further Details:      
 
Domain Number 2 Region: 998-1166
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-31
Family GAF domain 0.0021
Further Details:      
 
Domain Number 3 Region: 587-715
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.7e-28
Family Heme-binding PAS domain 0.07
Further Details:      
 
Domain Number 4 Region: 352-461
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.96e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0057
Further Details:      
 
Domain Number 5 Region: 829-989
Classification Level Classification E-value
Superfamily GAF domain-like 8.07e-17
Family GAF domain 0.012
Further Details:      
 
Domain Number 6 Region: 456-588
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-16
Family Heme-binding PAS domain 0.089
Further Details:      
 
Domain Number 7 Region: 714-832
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.96e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.055
Further Details:      
 
Domain Number 8 Region: 149-266
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000177
Family GAF domain 0.01
Further Details:      
 
Domain Number 9 Region: 1195-1237,1267-1298
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000053
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313071|ref|YP_007124048.1|
Sequence length 1514
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MRTTSTNKLPQAELKLAYGITVSIVNRAYNSSVQRVEQFSSIQEKRDSRFLWLLVGSVII
GSFIWLMQLIPLEGWSIQLAGVSTAVLVVLLAPVFLRRKGVAEAQAKSGTSSDELAFDLP
IESIQRLQKQSQVLMTLTQAQTLNRGNFQAIIEQITASAADALEVERVSVWLYNKDRSQM
ECVEVYDPNTDCHAPGSASPTRPLTPSPHHLRPVAIANRLDAPIWLNEKIVGVVCYEHLT
PTSTSWTPQDENFASAIANLVAIALDVNVKLTPKENYQSRYLLSVNVSELGIRDSAAIVS
PEVSSGSRATASSALTTSLPERDAPKSQELDNHPQAADPPESNASDRFVAPNSTELLCHY
TPAGIFLYASPAYCTLLGYALDELIGQSVYDFCHAQDVAALQQFYANLLNPQPSEPINYR
IRRQNGKYVWLETLSHAILHPDTKVVAEIVALSRDITQRKQIKEALRASERQLQKLTDNV
PGIIFECLLRADGSLSFLFVSRGVREICQLEPREIQQNPQVLINLIHADDRLRFNCSVAR
SAKRLQPWRWEGRIILASRQVKWIQAASRPELQANGDMLWNGIVIDISDRKQAEAILHES
EDRFRATFEQAGVAIAQVAANGQFLRVNPKLCEITGYKRRELLTKTLVEITHPEDRVATQ
ADLSEFFNDQRETLNFEQRYVHKTGSVVWAKVTVSLVREPSGVPQYCISVIEDITERKQA
EALLNQANRDRINLLESITEAFFAVDREWRFTYINSKTEQFLSRCADELLGQSLWEVFPY
AVDSQFEQQYRRAVAEQASVKFEEFYPPLQLWLQVRAYPYEGGLSVYFSDITERKQAEAG
LLKRSRLSSLAAEVGIALANGGSLLRILQLCTEAMVQQLHASSATIWTLNPASQRLEQQV
ATGQRFPLQPDLINLVAQTRQPYWTSDEDGTNISTSSSPSLSHHFSGYPLVVEDRLMGVM
AVLSHHPLSEEARDTLSWVANAIAIAIDRYWARSELLTRRESLLFGLANQIRNSLELDII
LETAVQSIRSLFQIDRCHFLWYGNQGDEPYWEVVHEARNPNLESHIGRYTMTQVRLSADR
LLNRQIIQIDRVETFKNPRLRKFLLNMGYTSVLSIPIKTHDGAIGVISCGHCTSARPWDE
SEVELLLAVVAQLAIALEQAELYAKARQAAADAQAKAQEVERALNQLRMTQAQLVQSEKM
SSLGQLVAGVAHEINNPINFIHGNLAYAGAYIYDLLNLLHLYQEHYPVPPAPIAEQAEVI
NIDFIATDLPKLLGSMQRGTDRIRTIVQSLRKFSRADEADMKKVDVHEGIESTLLILQHR
LKGKGKHPEIKIFKEYGSLPAIECYPGELNQVFMNILINAIEALKPLDLGIEPHSSLFAP
HPAPTITIRTRILEYCDSRTLTESSLGEIAQKALPEEIVEHPTSSSFPTDTLSRQSSQRV
VIQISDNGPGMTESVKAKLFDPFFTTKPVGQGSGLGLSISYQIIVEHHHGILTCTSIPGQ
GTEFWIEIPIQQLL
Download sequence
Identical sequences K9WM95
gi|428313071|ref|YP_007124048.1| WP_015184777.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]