SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313134|ref|YP_007124111.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313134|ref|YP_007124111.1|
Domain Number 1 Region: 557-728
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.29e-39
Family Histidine kinase 0.0028
Further Details:      
 
Domain Number 2 Region: 749-866
Classification Level Classification E-value
Superfamily CheY-like 9.68e-30
Family CheY-related 0.003
Further Details:      
 
Domain Number 3 Region: 256-364
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.84e-28
Family Flavin-binding PAS domain 0.00046
Further Details:      
 
Domain Number 4 Region: 361-483
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.86e-23
Family Heme-binding PAS domain 0.031
Further Details:      
 
Domain Number 5 Region: 496-562
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000373
Family Homodimeric domain of signal transducing histidine kinase 0.0045
Further Details:      
 
Domain Number 6 Region: 7-96
Classification Level Classification E-value
Superfamily AhpD-like 0.0000162
Family AhpD 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428313134|ref|YP_007124111.1|
Sequence length 880
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MRTSEQIKAEIEEKLGFFPPFFSPALQTPQVLENLWHQTINAYLNNPLPDLFKERLSAYL
SRFCVVPYCMICHSCSLYFLGVQAREVLELLESPLPTQTDIDEHLSLLATQLNGLTLWPE
SNSPLEKSLLYCSIFITLERDEAQHCRRELRRLLGCVNYQYLVTFIAYVKSCHLWMEAHP
EVSYLADNRVSAHFDTLVKEEPGLADFFKNYWERAKREQRSWTEQLAANALRQRHEQELQ
KAAVENLRLARAIASVSDGVLITDPKQPDNPIIYSNPAFSKITGYQPEEIFGRNCRFLQG
AETDSEALRTIRHAITQRQEVKATLLNYRKNGQSFWNELKISPVFSEQGDLLYFIGIQTD
ITERKQAEEKIRFQAALLDITTDAILVRDLQDQILFWNQGASRLYGWQAEEVFGKKAQHL
LNEEKTPQLAAMLSTVAMKGNWQSELHQVNKDGKKILVESRWTLMYDEENKPQAFLVVNT
DITEKKQLEAQFFRTQRLDSIGTLASGIAHDLNNVLAPILMSAQLLSQPQLSEKKKPDLL
KTIESSAKRGAALVKQVLSFARGVEGQRTTIQMKHLISEIRQIVNNTFPKFIETHTDISQ
DLWMVSGDATQLHQVLINLCVNARDAMPRGGTLSISASNMVIDESYARMNIDAHAGAYVV
FTVKDTGVGMPPEVVERIFEPFFTTKELGKGTGLGLSTVLTIVKSHGGFLEVTSTLDEGT
QISVYLPASEATKIPKILDSEFFQGQGELILVVDDEAAIRETSKTSLETYNYRVMTANDG
IDAIALYAQHQQEISLVLIDMMMPLMDGSTTIRTLKKINPHVKIIAVSGLISSNRLTQST
NYGAQAFLAKPYTTTDLLKTINEVIPSLVRCQITVEAEQK
Download sequence
Identical sequences K9WJW9
gi|428313134|ref|YP_007124111.1| WP_015184838.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]