SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313141|ref|YP_007124118.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313141|ref|YP_007124118.1|
Domain Number 1 Region: 214-388,439-512
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.7e-70
Family Hsp90 middle domain 0.00012
Further Details:      
 
Domain Number 2 Region: 4-212
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.94e-60
Family Heat shock protein 90, HSP90, N-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 540-670
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 0.0000000017
Family HSP90 C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313141|ref|YP_007124118.1|
Sequence length 675
Comment molecular chaperone of HSP90 family [Microcoleus sp. PCC 7113]
Sequence
MTILEQGNITIHTENIFPIIKKSLYTDHEIFLRELISNSVDAIQKLKMVSYAGEVDGELE
EPEIVITIDKDNKTLSISDNGIGMTADEVKKYINQVAFSSAEEFIQKYQKDADQQIIGHF
GLGFYSSFMVAKKVEIDTLSYRAGAQAVHWSCDGSPAFELTDSTRTQRGTTVTLTLQDEE
QEYIEAMRIKQLVKAYCDFMPVSIKLDGEQINKQRALWKESPQSLTTEDYLEFYRYLYPF
QEDPLLWVHLNTDYPFLLNGILYFPKLKPDVDVTKGNIKLFCNQVFVSDHCEEVIPKFLM
PLRGVIDSPDIPLNVSRSALTNDRTVRRIADFIAKKVGDRLKSLYNEGRDEYIRCWQDVG
TFVKFGSLNDDKFKKQVEDIIIYRTTHEAGEQGSKGTGEQASNPETPTVEVQSQEGDAWQ
EVTPSNTEDNPKSNTQKSTSNYTTLKEYLERNKEHHENRVFYCNDEASQATYVELHKNQG
LEVLFMDSFIDPHFISFLEREYSDVKFSRVDSDLDQTLIDQDKEKEIVDPKTNKTRSEVI
KELFEKSLNKPKVNIKTQALKSDDAQGTPPAMVLLPEAMRRLREMTALLQQQNAEFPEEH
VLIVNTSHPLIENLYELSQGSIVQSSGQSPSGELANLICQHVYDLALMAQKGFDAEGMKS
FVERSNQVLTRLTQR
Download sequence
Identical sequences K9WME9
gi|428313141|ref|YP_007124118.1| WP_015184845.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]