SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313161|ref|YP_007124138.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313161|ref|YP_007124138.1|
Domain Number 1 Region: 473-666
Classification Level Classification E-value
Superfamily GAF domain-like 1.24e-49
Family GAF domain 0.00029
Further Details:      
 
Domain Number 2 Region: 6-206
Classification Level Classification E-value
Superfamily GAF domain-like 6.28e-48
Family GAF domain 0.0000302
Further Details:      
 
Domain Number 3 Region: 684-849
Classification Level Classification E-value
Superfamily GAF domain-like 1.11e-47
Family GAF domain 0.00076
Further Details:      
 
Domain Number 4 Region: 964-1170
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.98e-39
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 5 Region: 351-444
Classification Level Classification E-value
Superfamily GAF domain-like 1.13e-22
Family Phytochrome-specific domain 0.005
Further Details:      
 
Domain Number 6 Region: 215-390,425-450
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000432
Family GAF domain 0.019
Further Details:      
 
Domain Number 7 Region: 875-915,945-976
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000235
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313161|ref|YP_007124138.1|
Sequence length 1182
Comment histidine kinase,histidine kinase,GAF domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSQPELSQEDLLRRITNRIRQSLELEEILTATVAELRSLLGTDRVIVYQFHASGSGEVMA
ESIQDNCLPSLKGLNFPADDIPETARQKYMEKRLCSFVDVGLGRIGWLPIDCCITSEETI
PLEELVEYHPVDSCHAAYLTAMGVQSTVVLPIVHNNIQSEHAKEQLWGLLVCHSIQLRVI
SRRELQVMQWAIDQVSIAIAQSHLLAKTRQQHFVEATTNRVATLLHSLPTIELSAALEET
VTALQGCGGRLYIAPYTTDDRAEVLTCGTQLAPLIGETESLIEQHPVFTAWTSCLEENTL
FLRERREPEENSSSQPGNPPIDSSPTPTPKGVPFFPSCSPLTVTNLYSLPDWRTLTPAFQ
FTTIRGILVMPLYYRSSFLGYLSIFRPEIDTETLWAGRFDPSEKQRLPRQSFEVWRELKR
GQAKEWTRQDIELAVALGHQFAMAIEQYELYSLVQSLNANLERQVEERTAKLQQALEQGR
ALERVTSQIRSTLDLNTILQTIVREVRSLLDTDRVVIYQFADNAQGKVIVESINGDWFST
LGASDPHGYFLETQSQPYKRGRVRVISDVARAPLAPAQREFLQRFHIQATLIVPIGMGAY
HSQDIFSCGCTPTSLHKNQEEQPLWGFLIAQECHAPRSWQAFEIDLLQQLADQAAVAIQQ
AELYDKSRTAAATATAQAKQLAIVAQQQQALFGVITKIRESLDVKAIFKATTTEVRRLLA
ADRVAVFRFAPEFGYDHGEVVSEDIQPGLPEANRNIQDYCFGEKYRSGWIQAIPDIYNAG
LNDCHIKILEQLHVRSTLMVPLPKGDTLWGLLCIYQCTGLRYWDTSEIDFVRQVAVHLGI
ALQQAGLLEDKEQQAAEIAFTLENLKQAQTQLIQTEKMSSLGQLVAGVAHEINNPVNFIY
GNLTYTNQYAHDLLNLLHLYQKYYPEPDLEVDEYAKAIDLDFLKEDLPKILASMKIGSER
IRNLVLSLRNFSRLDQAEMKPVDIHEGIDSTLLILQHRLKGKPNYPGITVVKTYSELPLV
ECYASQLNQVFMNVLSNAIDALEDYHISRTAEGMKVHQSQITISTRVKPVDLERIGDRNG
ENSPSSLPTSPHVVIEIADNGPGISPALLSKVFNPFFTTKPIGKGTGLGLSISYQIVVEK
HGGSFRCDSQIGQGTQFRIEIPIQQPKPTPERPLLASEPVRG
Download sequence
Identical sequences K9WMG6
gi|428313161|ref|YP_007124138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]