SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313165|ref|YP_007124142.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313165|ref|YP_007124142.1|
Domain Number 1 Region: 994-1110
Classification Level Classification E-value
Superfamily CheY-like 3.7e-31
Family CheY-related 0.00081
Further Details:      
 
Domain Number 2 Region: 644-821
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.49e-28
Family Histidine kinase 0.0000623
Further Details:      
 
Domain Number 3 Region: 22-131
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.00000000000114
Family Chemotaxis protein CheA P1 domain 0.013
Further Details:      
 
Domain Number 4 Region: 820-965
Classification Level Classification E-value
Superfamily CheW-like 0.000000017
Family CheW-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428313165|ref|YP_007124142.1|
Sequence length 1113
Comment chemotaxis protein histidine kinase-like protein [Microcoleus sp. PCC 7113]
Sequence
MSIPEIDSSQGIEALADAQLQQELYSLFIIDTQEYLQKYSQIAQSLQPQSWRADIQELYR
CIHTIKGGAVTVGALAVLDVATALEDVLSDLRYLELAPLLGDGHLSQALLEAGELLTVTV
EFQQSKENDPLLNRIQVLHEEIRKRYLSQWNELRQLHQDFAEQGLDLVVLELEIALEQLP
AQGTVPARTLHTAQQTLEQLEQIGQELQFAPGWTDLLTQAQTLLNHPDNAIWRLSKEQRH
GQSQWSLLFQALKTCAKQSGNPVFFEFASFEASVDDGRVAEPQFYLETTPEDDSAQLEAD
LLSQSNLLSLEPNPSDAFLDDSSQTDTLDDVGAFLDALNLGENSTIPEITNFLDAFPLED
WANLTEVEPPLAQPNPVDALTDPEEVEAFLNQDDSADLPLDFSQVQEWLDETSLDDFVAH
PPTPTQEQDSVVDQVQASLEVGVDWVNWGYESDEGDEWQWEDKGEISSPPSPPAPSSSPA
ELPPVVIDIATAKAERSNKALEMVQIPVPLEKLDQSAKYLVDTLLSLRSTQGFYQALQHQ
IAQLVTLAQESAQAIAHLRQIQDDYVLLDELSKSTQTGSQGLVRERYRQGYTIINRLLET
SLRLSEMGAETGKTSQQVAEYLRNVDNNVLKLQNTIEDSRLVPFQNLGFRARAIIRDLTT
RYSKPAKLVVQGEQTELDVNTARNLEPLLLHLIRNAYDHGLESSAERVAQGKPEQGTLTL
SLQRLGNLFQLELRDDGRGIDAKAVQARAEALGLPLSNTQTPAELLAVICQPGFSSRTQV
SEISGRGIGMDVIAAQVARLGGRMTLHTVQGSGTTFHLKFPVPRLLVSCVMLRSGDSTFA
LPVDDIKTINLLCNLNLSPVKDSNPALLGMIEDETGRLAALDLLKYWQPHSSTRPLTDTT
ICLSIYGEEATQGVWLLADELLEQAEVIINPLPKPMVAPDGLIGVSLQTNGALLPVLDAP
TLAKRLLTFSTHVLGTASTASSTSEVEQANHLTPSILIVDDAALMRRRLEATLNTYGYPT
HSCVDGLEAWNWLQAHPHPNLVITDIEMPNMDGFTLIDRCRKAGITVPILVISSRLSEEW
FDEARRLGATDYLTKGFSSIGLIEKVRVLITAT
Download sequence
Identical sequences K9WLQ3
gi|428313165|ref|YP_007124142.1| WP_015184869.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]