SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313167|ref|YP_007124144.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313167|ref|YP_007124144.1|
Domain Number 1 Region: 554-863
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.74e-24
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0018
Further Details:      
 
Domain Number 2 Region: 382-524
Classification Level Classification E-value
Superfamily GAF domain-like 8.94e-22
Family GAF domain 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|428313167|ref|YP_007124144.1|
Domain Number - Region: 300-349
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00196
Family HAMP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313167|ref|YP_007124144.1|
Sequence length 889
Comment periplasmic ligand-binding sensor domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MKLQNKVLLSLGVGLVGLSIGFYLISRTLLTKSYIALENQQVNKDVQRVLDILTTTLDNI
SRQTRDYSRWDDSYQFIINRDPVYIDSNFTNDHLANLRLSAAIYINKSGKIVFSQGVDFN
QNKEVPVSQAFLAQLSPSSPLLKHPDPKSEHLGFIQLPEGPMMLTSQPIITSEGTGPIRG
TLIMGRYLDQPFIQQLKDLTKLPDIKLEPFEAKQLAPDFQQARKAFMQGKQSFAKPLNQD
SIAGYALLKDISGKPAFLLRVTEPRTVFARGQASLNYLVIGILLLGSMFSIAIIWFLEKS
ILSRLSRLSNTVSQIGTNGILAERVFLSGNDELSHLAATFNSVFDRLEQSQGRLQAYAEG
VQRQNTVLASLSRDESLAQGNLEQAARLFIKATAETLGVDRVSIWLYNSDRSQLTCLELY
DHTLERYFTGMTQHQADFPQYFEALSQNKSIIVNDVHSDPRTLELVESYLTPSHIVSLLD
LPIQISGYPAGIIRCEQVGTRRRWQMEEQTFVYSIGSLLALTLQSSILQDEVKHLLDVVL
LAAEGNLTAQVTVSDHITGVVADTFNRFIERLAEVLDEVWTAARQVSQGANQQTELAETV
ATNADQQAQAVGQVLSLTEQVENAAQGSAERATASNESLQTVSTTLIQGQEAIAALTQGI
TILQEGTDRIVQRMKTLSEFVGLADQFVQNQNQIAFITQTLSLNASLVAARASEQRDPRQ
FVVVAREFDSIADQVSKLAQQTSEGLTALEQQSAQIHSVVSAVDSDVQGLGDLVRQFTTG
VEQSNQVFDRVQKVTGEAVQAGEAVAHFSEDIVGAAQTTAMVMRDIAGLANKTAELTQIA
RERSDQMDLLSAQLLQTVQFFQLPSASETDSHVPTESDSESLLLAADRT
Download sequence
Identical sequences K9WKM5
gi|428313167|ref|YP_007124144.1| WP_015184871.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]