SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313231|ref|YP_007124208.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313231|ref|YP_007124208.1|
Domain Number 1 Region: 15-182
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-48
Family GAF domain 0.00023
Further Details:      
 
Domain Number 2 Region: 514-643
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.22e-28
Family Heme-binding PAS domain 0.029
Further Details:      
 
Domain Number 3 Region: 333-462
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.58e-21
Family Heme-binding PAS domain 0.043
Further Details:      
 
Domain Number 4 Region: 206-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.77e-16
Family Heme-binding PAS domain 0.058
Further Details:      
 
Domain Number 5 Region: 719-864
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000812
Family Histidine kinase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313231|ref|YP_007124208.1|
Sequence length 865
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MALSRLPEPFLVCEQILDCIGAIALGITQAQSLNTILNTAVEEVRKILQTDRVLIYRFQS
DGSGVVVVESVDVNWTSILNQTLDDSCFANHWAEAYNSSQFRAIEDIYTCEIQPCYLEFL
AQLQVRANLIVPILANPPMPQSNRQNPLWGLLIAHHCSSDRSWQPLEVKLLQQVAMQVAI
GFATTQRAIAIGQTQAVDSWHTEAIQRQEVQAKLQASQEFLHSIYEGAANSIFVVDVLPS
GEFRFAGLNPAHEQLTGLRRQDIVGKSPEQVLPSTAAAAVSANYARCVEAGTTISYEECL
PFQGKEAWWLTTLTPLRDAQSRIYQLTGTSINITDRKQAEEKLTRQKEFLRNVIDTNPNL
IFVKDWEGRFTLVNQALANMYCTTVEGLTGKTDTDFNSNPAEVEHYLHDDRQVMNSLQSK
FIPEETLTSRTGEVHYLQTLKKPLISPDGKARYVLVTATDITDRKRAEQERDREVAAKHR
LFEQIEQQNQTLEAKVRERTAQLSIANEQLQQEVRERKRIEEALRESEQQFRQIFQDASI
GMALTDFHTHQFIQVNPAWCRLLGYSASEIVSLTFDQITHPDDLPQDLYYLEQRDQGKLD
SYRLEKRYFKKNGELIWANLTVTVLREQEGLPKFTLAMIEDITERKQAEELIQASLLEKE
TLLKEIHHRVKNNLQIISSLLRLQSRQIKDQWTLELFKESQNRVQAMALIHEKLYQSSNL
AQIDFQEYITTLVEHLCRSYDIHQPAITIKINVKPVPLPIDTAIPCGLIINELVSNSLKY
AFPGNQGGEICVNLQFKASPLNAPVHREQFILTISDNGRGLPEDLDFRNTRSLGLQLVCR
LAKQIGGSLELSRSQGTEFKLIFAL
Download sequence
Identical sequences K9WMN1
WP_015184935.1.75295 gi|428313231|ref|YP_007124208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]