SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313232|ref|YP_007124209.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313232|ref|YP_007124209.1|
Domain Number 1 Region: 199-363
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.55e-45
Family Histidine kinase 0.00072
Further Details:      
 
Domain Number 2 Region: 1-135
Classification Level Classification E-value
Superfamily CheY-like 1.57e-34
Family CheY-related 0.0011
Further Details:      
 
Domain Number 3 Region: 128-211
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.89e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313232|ref|YP_007124209.1|
Sequence length 366
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MSKAKILVVEDEEIVAFDIESTLKDLDYEVPSVVASKEEAITFAAAIQPDLVLMDIMLQG
SMDGIEAAQEIRSRFNIPVVYLTAYADSHTLQRAKITEPFGYVLKPFEEKELQTTIEIAL
GRHKAEERIRQALAKEQEISELKSQFISMASHEFRTPLATINSSNDLLQRYCRDSMDAKK
SKHFYQIQTSVAQMIQLLDDVLLIGKANAGKLEFKPAPLNLLEFCRRLIEELQLNAGRQH
KISFTSHGECTHVCMDENLLRRILTNLISNAIKYSPQGGKIIFELAYKDKIVVFDIHDQG
IGIPVDSQKELFTPFYRAANASKIKGTGLGLSIVKRCVDLHHGQICVKSEVGLGTTFSVT
LPRVSG
Download sequence
Identical sequences K9WKT8
gi|428313232|ref|YP_007124209.1| WP_015184936.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]