SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313377|ref|YP_007124354.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313377|ref|YP_007124354.1|
Domain Number 1 Region: 683-983
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.88e-66
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 11-75
Classification Level Classification E-value
Superfamily TPR-like 0.000000108
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number 3 Region: 596-634
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000772
Family HAMP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313377|ref|YP_007124354.1|
Sequence length 989
Comment methyl-accepting chemotaxis protein [Microcoleus sp. PCC 7113]
Sequence
MASGTDFAQEYGQAEKAYMQGNYQEAATICDRLVEDFPENPSVRLLLGHIYCYGLQQYDV
ARQQYEAVLTLTSEQDFIEYANNGLEYANQLMNGAGSGEETASSDDFDISYGDLGETDEL
GNSSNFENWSNLAAEDDVSSGFDLGSLDFDEVGSDTFTSRSESPFDNPFGGSGMDEQQPP
ESGHASDTPFAFSSDFGEDSDDLETFGTSTSGFELDDSVFGSPGLEDTPEEFFPDPGADE
TDMTFVIPGSEEFDDTQTEDDFSPGFTPSSQFDVDFPEEESGTYRDEEIGEPFNSGYPVF
EDETLLMGSEDLDNTFAIDRDELGYLSDRRSNAAESLQEDNSLQDEPTFDSAYDQNGFNS
SDHFDFDTFDEAFGNQTFVMDEGTEAEEETITGIESRPSAREGFLDEFDVFDDDLGSIPD
FSLGVQDDMSAEGSDDADFDILSNSGAVLGATGGLGLNEAADIEAPRSGYRSSGGEDEMF
SINNPAEQIPIFNQTKDADNEPIVHVEQGWLAFFENASLNRKQLWTAVLTGAVSAVAVAI
VSNIAASTAPGPNQEAVISRLKSTGWAMSLVAGAASFGTTLLLGRVTEKQIKRSTTELQS
QFEAVSQGNLNVTATVYSEDEFGQLATSFNQMSRVILTSMSEAQRKAEEQEQAKEDLQRQ
VIRLLDDVEGAARGDLTVQAEVTADVLGAVADSFNLTIQNLREIVQQVSQAAKQVNRGSA
DAETFARSLSSDALRQAEELAVTLNSVQIMTDSIQRVAESAREAEDVARTASETAVKGGE
AVERTVAGILQIRETVAETTRKVKRLAESSQEISKIVALISQIASRTNLLALNASIEAAR
AGEAGRGFAIVADEVRQLADRAAKALKEIEQIVLQIQSETGSVMTAMEEGTQQVIDGTKR
AEQAKRSLEDIVQVSNRIDALVRSIAADTVEQTETSRAVAQVMQSVELTAQETSQEAQRV
SGALQNLVGVARDLLTSVERFRVESNGGK
Download sequence
Identical sequences K9WL80
gi|428313377|ref|YP_007124354.1| WP_015185081.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]