SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313417|ref|YP_007124394.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313417|ref|YP_007124394.1|
Domain Number 1 Region: 475-781
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.27e-64
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000276
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000837
Family HAMP domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428313417|ref|YP_007124394.1|
Sequence length 782
Comment methyl-accepting chemotaxis protein [Microcoleus sp. PCC 7113]
Sequence
MTQIPPQNSFTKTSNEYPFAPNNLPVGDETPVMEESASSPTLLSSEKPESYLQNLDLSVQ
EQQTPWKRFSNQAFISLRTKATALALAIGTIPVALVGTTAYLTASTGIKAEIIQNEQHNT
ASLQQKLNLFVKQRYEDIVILSKFDAFTNSQVRNSLTSEGKNAILKDWIDSGKIYNSIVV
YNPPQRETIASAGDKFDLEPVLKADYTQAVLETDRPIIVDPRQSLTQGVGFSFYTAAPVK
DKSTNKTVALVRTRASMAAVKDFFYQGEANLGREFYITDSQGKITASSNPKAVEKNLADL
FPKLSSRLQKGGKQKLTTILSEKGQEQIFTYVPNEELRRAYGLNWSLVVARPTVVAFAPQ
RQLLITLLLGTVFFTALVAVIAITIANRATRPILEATDAVVKIGQGDLNTRLIVQGDDEL
GLLVNNINDMAGQLGILLHEKERVADEQRQLTELLQSRVLELLEEVEPINDGDLTIRATV
TADDIGTIADSYNFMVSNLREIVTKVQFAATNVATTTSNNEQSIQALSQEAVRQTEEITV
ALKQVQEMAQSARQVALSAEKAAEVVRRASQTVEEGDAAINRTVEGIVAIRETVSQTRQK
VKYLGESSQKISTVVNLISEFASQTKMLAFNASIEATRAGEQGRGFAIVADEVRTLAQQS
AEASREIEKLIAAIQGETNEVIAAMEEGTEQVVMGTKLVDETRHTLSKITVASAEVSQLV
EEIAQAAIEQSGVSETVTQTMTNVAQISDKTSQEATVVSSSFEELQRVAKALQEDVAQFK
VS
Download sequence
Identical sequences K9WLB6
WP_015185121.1.75295 gi|428313417|ref|YP_007124394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]