SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313418|ref|YP_007124395.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313418|ref|YP_007124395.1|
Domain Number 1 Region: 605-789
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.5e-41
Family Histidine kinase 0.00000991
Further Details:      
 
Domain Number 2 Region: 988-1106
Classification Level Classification E-value
Superfamily CheY-like 3.42e-31
Family CheY-related 0.00081
Further Details:      
 
Domain Number 3 Region: 12-131
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 6.8e-23
Family Chemotaxis protein CheA P1 domain 0.0069
Further Details:      
 
Domain Number 4 Region: 790-935
Classification Level Classification E-value
Superfamily CheW-like 8.37e-19
Family CheW-like 0.002
Further Details:      
 
Domain Number 5 Region: 454-509
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000863
Family Homodimeric domain of signal transducing histidine kinase 0.0055
Further Details:      
 
Weak hits

Sequence:  gi|428313418|ref|YP_007124395.1|
Domain Number - Region: 487-600
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00366
Family DNA repair protein MutS, domain III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313418|ref|YP_007124395.1|
Sequence length 1107
Comment chemotaxis protein histidine kinase-like protein [Microcoleus sp. PCC 7113]
Sequence
MAVNPDIRDHAYKFFIEEVPEFLQVLEAGLLTLKQERSNTHIHSLMRTAHSIKGGAAGVG
LEAIATLAHRLENLFKALYSETVEVDTELESQLLSAYDCLRFPLMQQMASGQFDAAQALA
TAEPIFTQLEQRLGDAFAQVEHFDIPTSAQLGVDMTISIFEVDVGQGLEQLARVIRHPQD
YQVAGELRQQAEVFVELAEILNKPGLGVIAEAALSALNVHPEQALKITQLALADFQAYRE
AVLTGNATPDGNLSSALLELSQASVEFPAEQEPLVPNWSVNQQNEFGANHPFFEFDALDD
AIAELENFAFASDEREGNPSTTHATDPNQPFFSLLLDSERTQGERGGNGSEVEELASWEE
LLLDAAASAEIEASAPNSLIRLTSTLKGLQHQQGDKATGTNTSETIDVTAQAIETPSIEN
SPNHTFQLSPETTPLKPSSTPIHQENIPVTPTVTVRVDAERLERMNNLVSESAIRRSGLS
LENRQLQSSVQELLNRADAIEQIVEQLRKVSDQTLVPERNYNPQTVPDSVSQIREFATTQ
ADFDALEMDSYGTLHSLLQRFLEDMVQLKESVADIGLFAKQSDRTLDQLRKMLTNLQDEF
VWARMLPLGEVLNRFPRMLRDLSTTYHKPVTLKLSGTEVLVDKGVLEKIYDPLLHLLRNA
FDHGIELPEVRRQQGKSEQGVIEIKAYHQGGQTIIEIRDDGQGLNLEAIGRRALERGLIS
PEQLLHVSENQLRDFIFVPGFSTAKQVSELSGRGVGMDVVRSQLEILKGTLTVNSTPGVG
TTFTIGLPLTLTSAKLIVGLVGSKAIALPSDSIEEIVLPKANQIQRHGTQRFLPWRGQTA
PIYRVADLLDYGYPVPETPLGRALVVESSSADLIPPLLVFHRGQQVFALEVDHLVTEQKL
VIKPFGGVVAPPSYTYGCTILGDGSLIPVIDGVTLVEQSLGQESQTTAIATLSESEPSIE
FDPDRTTTDHSHASVNPTLTSLNTATTPTVLVVDDAASLRKTLAMSLERAGYRVLQAGDG
WEALKHLQSNAQVNLVISDIEMPNLNGFDLLNHRRQDPQLQKVPVMMLTSRSNDKHRRLA
MHLGATAYFTKPYIEQSFLKAIKDILN
Download sequence
Identical sequences K9WMI6
gi|428313418|ref|YP_007124395.1| WP_015185122.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]