SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313423|ref|YP_007124400.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313423|ref|YP_007124400.1|
Domain Number 1 Region: 529-623,664-738
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.21e-36
Family Histidine kinase 0.0059
Further Details:      
 
Domain Number 2 Region: 186-327
Classification Level Classification E-value
Superfamily CBS-domain pair 2.16e-25
Family CBS-domain pair 0.00095
Further Details:      
 
Domain Number 3 Region: 74-176
Classification Level Classification E-value
Superfamily CBS-domain pair 5.68e-20
Family CBS-domain pair 0.00053
Further Details:      
 
Domain Number 4 Region: 441-481,511-541
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000549
Family Homodimeric domain of signal transducing histidine kinase 0.0088
Further Details:      
 
Weak hits

Sequence:  gi|428313423|ref|YP_007124400.1|
Domain Number - Region: 10-46
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0668
Family CBS-domain pair 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313423|ref|YP_007124400.1|
Sequence length 759
Comment histidine kinase,CBS domain-containing protein,histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MQPNGLSIQSLALTHAIDTHFMTVAPDTPLVDVLALMSQFRSCMLPDGDRNFHKNPYEVN
RDRTEIDCMGQAGNAIFELSDTADGCVLVTEKLQLIGIFTERDIVRLTADGICLKSLNMA
EVMTRPPVTLRQSQEHDVFTALGLFRQHHIRHLPIVDEQGQPVGIVTHDSIRRALQPVNL
LTRLRYVKDVMTTQIVHASVNSSVLYLAKLMTEHQVSCVVITEETKLQEINTQHSNSSFP
ISSSQSLIPVGIVTERDIVQFQALELDLSRMIAQDVMSTPLFCLRPSDSLWHAHEEMHRH
HVRRLIVIGSEGELIGIVSQTSLLQVLNPADMYGVIEVLQQVVEERTAELKKTNERLRHE
IVERERAELALLEAHDHLKIQVEERTAQLTQANAQLQQDILERQRVEAALRQSEAKLRQQ
ATQLRLTLEELHSYQTQLIQTEKMSALGLLVAGVAHEINNPINFIYGNIAYASQYIEDIM
DLLQLYEQQYPQSLIEIQEKAEKIDLDFVRTDLPKLLSSMKLGADRIRDLVLSLRNFSRL
DEAEMKFVNLHEGLDSTLLILQNQLKAITGRSEIKVIKEYGNLPLVECYPGQLNQVFMNL
LSNAIDALEELRTLSAHCANCNSQHSLHAPTITIRTGLKEVRSKESIADSPSDRMATPPM
STLHAVIRIADNGSGMTESVCQHLFDPFFTTKAVGKGTGLGLSISYQIVVKKHGGQIKCI
SALGQGTEFVIEIPIAQRNPATGFVLDSLKSSFIEDSKV
Download sequence
Identical sequences K9WMJ2
WP_015185127.1.75295 gi|428313423|ref|YP_007124400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]