SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313477|ref|YP_007124454.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313477|ref|YP_007124454.1|
Domain Number 1 Region: 151-239
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 7.32e-17
Family VanY-like 0.015
Further Details:      
 
Domain Number 2 Region: 403-585
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.88e-16
Family N-acetylmuramoyl-L-alanine amidase-like 0.0014
Further Details:      
 
Domain Number 3 Region: 299-362
Classification Level Classification E-value
Superfamily PGBD-like 5.49e-16
Family Peptidoglycan binding domain, PGBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313477|ref|YP_007124454.1|
Sequence length 878
Comment N-acetylmuramoyl-L-alanine amidase [Microcoleus sp. PCC 7113]
Sequence
MALKLKILEDTIFKQQPTDSSQVSKPEDLYSVQKGSVFDLHSWDPSDGQPHHIRVALAKD
RFNNKNTWYVFTNHVQIWDDETVLLPKPSPPGSTQVLYDVRSCSTHVVRGLDQQVIDEMN
VVSGNILVSFEGLNVRLGNAVWPFLQPGAKNALERAIRDRGVPMVVNSCYRTIAQQLILF
NHYQAGGRCGIQLAARPPKSNHQSGLAIDIEDVFGWKPHLERYGWRWFGPADYPHFDYVW
GGRDIRNTAVLAFQRVWNRYNPGDRITEDGGYGPSTERRLNRSPIGGFGEVWLGFEILRL
TNPFMQGKDVRRVQQALVKANFKVDTDGVFGPGTQSVVRQFQRAKGLIADGIVGPATLVS
LGLVGLVPPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSVKRIFISAANDLKDPGVVA
LETTAAEEMILTRNALVKELQSRGVEFFVVPDSLDLKGTISWINNRVLPSDVAIELSGNA
FNGSVRGTEVFYIDGNEERKKAAQLLLEEFLEKVPELRLGKPLSRGVKPDTLSAKNQLPF
CRDVAASSVIFKLCFLDNPEDLKLLQNNRDRFAKGLADGLIQWSGQKETSGQPSAYFQPI
NIKIQNRDHEEKGLLINGNSYIPADLVESLGVNLAVEADIRQISYGNVLYIKAVDLQQFK
ISVGWDNETKTVLISTASQTDLDDSDKIIWFGNASEKDLNNFISTNNAEALKQFPNIARI
YIEEAEKEDVNHDVAFAQMCLTTNFLRFGDKLKPEQNNFGGIGTANNDPAGASFPDIRTG
VKAHIQHLKAYATTAPIEHPPIVSPRFQFVTRGIAPSAYDLSRRWSPDPEYGNKIMALVL
RLNGLVSNVEETSQAFVERLTRTAVAIDSNGASTQCAL
Download sequence
Identical sequences K9WLI5
gi|428313477|ref|YP_007124454.1| WP_015185181.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]