SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313625|ref|YP_007124602.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313625|ref|YP_007124602.1|
Domain Number 1 Region: 1066-1161,1191-1266
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-40
Family Histidine kinase 0.0035
Further Details:      
 
Domain Number 2 Region: 287-412
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.072
Further Details:      
 
Domain Number 3 Region: 151-280
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.33e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.095
Further Details:      
 
Domain Number 4 Region: 58-156
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.38e-20
Family Flavin-binding PAS domain 0.073
Further Details:      
 
Domain Number 5 Region: 806-936
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.09e-20
Family Heme-binding PAS domain 0.082
Further Details:      
 
Domain Number 6 Region: 655-802
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.59e-18
Family Flavin-binding PAS domain 0.057
Further Details:      
 
Domain Number 7 Region: 421-536
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.65e-18
Family PYP-like 0.081
Further Details:      
 
Domain Number 8 Region: 535-657
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000123
Family Heme-binding PAS domain 0.063
Further Details:      
 
Domain Number 9 Region: 976-1016,1046-1077
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000147
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313625|ref|YP_007124602.1|
Sequence length 1273
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MPIPSPSLDLTHPFANNPQPQELLTHSEEQFRTFVANIPGAVYRCIYDEQLKGLSLRTML
FLSEAIETVTGYSASDFINNRVRSFTSIIHPQDRIKIEQAIRQSISANQPYVMEYRIVKA
NGSTVWVYDKGQGICDENGHIQWLDGVILDVTERKTAEADLRYTQTFLNSVVEHLPMAVF
IKDAIDLRVMYWNKASEELFGYSREKVLGKNDYEFLPAQQARYLRANDRQVLAGGELVDI
AQAPLITPHRGKRIVHSKKVPLLDETGTPRYLLGICRDITEEKLADTEAAQSAQALRDSE
AHYRRIVETATEGIWMFDANSKTTFANSRIAEMLGYTVEEMQGRSFFDFIDEESRVQAQA
YVERRRQGIRERHDFKFCRKDGSLLWAIVSATPILDAEGQFVGVLRMITDISDVYDELRL
RKQAEEALRQSHQQIADILERITEAFFALDHQWQFTYINGEASRLLQRQPEELIGANFWD
VFPEAVGSFVEQQYRQATQEQVPVIFETFSAPLNSWLEVRAYPSGSGLSVFWRDITEQKQ
AQDALRKSEEQYRTLASHFPNGAVLAFDRELRYTLAEGEALATLGLSKELVEGKTLWEAR
SPELCEILEPHYRAALSGVAGIFELEYANHTYLVHTLPLKNDWGEVFAGMVMKQDITDRK
RSQEQLQERELFLRSIYDGVEDGIFVVDVLETENLGARSQESEVIQEEKPIPGYEFRYQG
LNPAHERLSGLCSADLRGKTPQEVLPPDLAAAVSQRYEECVRAGTAISYEECLPLPGEDA
WWITTLSPLRDRQGQIYRLVGTSINISDRKQAEVALQESERRFRAIFDSMFQFIGLMKPD
GTLLKANQTALDFGGLCLEDIAGRPFWETRWWSLSAQIQERLKAAIAQAAAGEFVRYEVD
VLGAGNQVITIDFSIKPVKDETGQVVLLIPEGRDISDRKRTEEALRKSESQLRAKNQELK
RTLHQLKNTQAQLIQNEKMVSLGQMVAGIAHEINNPISFIYGNIAYAHEYAQNLLNVVKL
YGLHYPEPLPLIQDEIEALDLDFVATDFPKLLDSMQEGANRIREIVLSLRNFSRLDEAQI
KPVNLHEGLDNTLLILQHRLKAHAGKSGIEVRKEYGQLPLVECYPGSLNQVFMNLLSNAI
DALETQPQPRVITIRTEVETGDQGRAGEDESTRMFQLNSRMLSTPLPPPQCVVIRITDNG
PGIPLEVKKQIFDPFFTTKPVGVGTGLGLAIAYSIVVEQHRGHLTCMSEPGQGAEFVIEL
PIRQPSLSNATSV
Download sequence
Identical sequences K9WN24
gi|428313625|ref|YP_007124602.1| WP_015185329.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]