SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313663|ref|YP_007124640.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313663|ref|YP_007124640.1|
Domain Number 1 Region: 362-553
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-38
Family Histidine kinase 0.0042
Further Details:      
 
Domain Number 2 Region: 98-237
Classification Level Classification E-value
Superfamily GAF domain-like 1.65e-23
Family IclR ligand-binding domain-like 0.064
Further Details:      
 
Domain Number 3 Region: 272-313,343-373
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000053
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313663|ref|YP_007124640.1|
Sequence length 555
Comment histidine kinase with GAF domain [Microcoleus sp. PCC 7113]
Sequence
MLKKILKKAVRLLRHWMQALNLGSRQKRGGSFRPPRWSPQPTTQELTLEQTTASISQTSP
SRRETQSAKATPKPDNEAARLKALARYKVLDTFPEVEFDDLTALAAHICGTPIALVSLID
AHRQWFKSKIGVEATQTPREVAFCAHAIVQPDELLLVPNALEDERFANNPLVTTDPKIRF
YAGAPLVTPDGFPLGTLCVIDRIPRTLSPEQREALWALSRQVMSQLELRIHVSKLERTML
KRKKVEEVLRRRNQQLNQTIEELRHTQAQLIQTEKMSSLGQLVAGVAHEINNPVNFIHGN
LPYISDYIEDLLELLFLYQYHYPNPVSEIQQELEARDVDFIAEDLPKILSSMKLGTERIH
QIVLSLRNFSRLDEAEKKPVNIHEGIDSTLLILQHRLKATSARPAIEVIKKYGDIPLVNC
FAGQLNQVFMNLLSNAIDAFESGQEPTLESKPGITPCITICTEVVHHGGENILSRNQLTT
ERVKICITDNGSGIPDAIKRRIFDPFFTTKAVGDGTGLGLSISHKIVVDQHEGSLQCLSK
PGQGTEFRIEIPITD
Download sequence
Identical sequences K9WN92
WP_015185367.1.75295 gi|428313663|ref|YP_007124640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]