SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313720|ref|YP_007124697.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313720|ref|YP_007124697.1|
Domain Number 1 Region: 1287-1459
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.8e-46
Family Histidine kinase 0.0027
Further Details:      
 
Domain Number 2 Region: 1477-1598
Classification Level Classification E-value
Superfamily CheY-like 3.13e-34
Family CheY-related 0.0047
Further Details:      
 
Domain Number 3 Region: 606-775
Classification Level Classification E-value
Superfamily GAF domain-like 6.11e-26
Family GAF domain 0.0043
Further Details:      
 
Domain Number 4 Region: 316-441
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.042
Further Details:      
 
Domain Number 5 Region: 790-898
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.36e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 1063-1215
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-21
Family GAF domain 0.003
Further Details:      
 
Domain Number 7 Region: 1215-1299
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.71e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 8 Region: 75-179
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.22e-17
Family PYP-like 0.043
Further Details:      
 
Domain Number 9 Region: 172-313
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.15e-16
Family Heme-binding PAS domain 0.059
Further Details:      
 
Domain Number 10 Region: 892-1036
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000096
Family Heme-binding PAS domain 0.053
Further Details:      
 
Domain Number 11 Region: 439-580
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000174
Family BphP N-terminal domain-like 0.048
Further Details:      
 
Weak hits

Sequence:  gi|428313720|ref|YP_007124697.1|
Domain Number - Region: 18-51
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0823
Family CopG-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313720|ref|YP_007124697.1|
Sequence length 1602
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MKRDATGKFVSNWNSETKQRVSVSLTNTAWRSLDREAHKRGISRSEVIERFARTLELESE
QLLAAQETDRKVATILENLTDAFVAFDHNWRYTYVNHAAAQILHRTPDELLGKHVWHEIF
PELVGGLAYQELHRAVAEQAPVSWEEFGEPVQRWLEANAYPSAEGVAVYFRDITERKQAE
AERERLLHELEIERARFEAVLRQMPAGVIIADAASGTLVLANEQAKQIVGYDYEESLELE
EYVPITPFEAFSSDGRVYAPHEYPLARSLQTGEVVTSEEMALHRDDGSRIFININSAPIL
DSQGQIVAAVVIFKDVTDYKQVEQALRESEERLRLALTAAQMVVWDMDLQRDQVLCSANA
LDIWGLQEGTAEDFFAVIHPDDRQPVMQAAQRAMAGEESYMKEYRVIDPHGTTRWINSQG
QTYLNNAGRGVRLIGVSVDITERKQMEAERDRLLKREQSARREAETERQRLHDILMQLPA
MIGIVKGPDLVYEFANPTLLQVAGRTPDIIGKSMREIFPELEGQIYFDAVKRVYQTGEPF
IGNESPAYWDRNGDGVLEEAFFNFTFPAWRDARGTIQGVLLYGIEVTAQVQARQQIDSLL
AELQHKERQQQFLIELNDAIRAIQDSQEIIWQVVRDTGQHFQVTRCTYGEIDATQEYVIV
DRDYCNGVISVVGRHQMDSFGRELIAELKQGKTIVVDDVDTDPRTAGSGAATFDAIQTKS
LLCVPLVKAGRFVALLVLHHISPRHWTKEEVVLMERIAQKTWLAVERSRTEAELRESEAR
LQLALRVGRMGTWDWDMQTHASLWSEGHFTVLGLQPNECEPSYEIWASRVHPDDLAEVEA
KLQQALADKKEFHDEYRLRWSDGSIHWVEARGKFTYDSQGNPKHSIGVVIEITERKQAEQ
EREQLLERERIARSEAEAAQHQLATIFDTSPVGLALLDEKQRFIAINEALAEINGLTREQ
HLGHSIPELFGHSDPQLVEVFHQIYTTGNPFISPNFAVNVPGRNDRRPGYYNVYYLPTVN
SKGQVEGVLVYVVDVTERLQLEHAQRFLSEASAVLASSLDYQTTLEQVAQLTVPELADWC
TVHMVEEDGAIAQIAVAHIDPAKLEWAYQIRDKYPLNPDDPRGAAYTLRTGESDLVPEIP
DELLVHAARDSEHLEILRQVGFRSVMTVPLRTQTRILGVISFISAESERQYTLTDLQLAE
ELARRASLAIDNAQLYRVAQRDRAKAEAANRIKDEFLAVLSHELRSPLNPILGWTKLLRT
GRLDATKTQQALETIERNAKLQAQLIEDLLDVSRILQGKMMLNVAPVNLGTTIEAALETV
RLAAEAKHIQIQTLLNPIFGTVSGDTNRLQQVIWNLLSNAVKFTPAGGRIEVQLKQVGTY
AQIQVKDTGKGISPEFLPYVFDYFRQEDGTTTRKFGGLGLGLAIVRYFTELHGGTVQADS
PGQNLGATFTIRLPLNVVEPEPSSDHKHPESATDLAGVHVLVVDDDADMRELAAFTLMGS
GAEVTTAASAAQALTFLNQSVPDLLLCDIGMPEMDGYALIRQIRKWSPEKGGMIPAIALT
AYAGEINQQQALAAGFGMHISKPVEPEELVKAIARLLTAIFR
Download sequence
Identical sequences K9WNA9
WP_015185424.1.75295 gi|428313720|ref|YP_007124697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]