SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313727|ref|YP_007124704.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313727|ref|YP_007124704.1|
Domain Number 1 Region: 534-713
Classification Level Classification E-value
Superfamily Nucleotide cyclase 8.79e-40
Family Adenylyl and guanylyl cyclase catalytic domain 0.00027
Further Details:      
 
Domain Number 2 Region: 723-856
Classification Level Classification E-value
Superfamily Globin-like 2.83e-34
Family Globins 0.0031
Further Details:      
 
Domain Number 3 Region: 457-505
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000314
Family HAMP domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313727|ref|YP_007124704.1|
Sequence length 866
Comment family 3 adenylate cyclase [Microcoleus sp. PCC 7113]
Sequence
MLNLQNRLPKFRNGSLINLRLGNWTIQSKLQALLMAVSFGSVVVVSGIGWYRTQAILKTK
ITEQLAGIRTTKAEQIEAYFEDLNNQVAMLAADGNIVKAMVELNGGFRTLENNLISPEWD
TALNAYYTKEFFPRLQKNLTSEVVNPSVYIPTGQAARYLQYHYIASNPNPVGKKNKLLDA
GDGSNYTKAHAKYQSFFAEIIEKFGYYDLFLINPQTEDIIYSYFKETDFATSRLQGFYSD
SALTNLVQKVQANPTQGSIQIADFKPYRPSYNAPAAFLATPIYSGSNKIGILAVQVPINK
MNQALNRNNSWETSGLQKTGEAYLVGPDSLMRSISRFWVEDPKKYQNVIRYTGIDQRTLQ
LMESFNTTIRLQKVNSSAAQAALEGKQGMMVTRNYRGREVLSSYSPVKVNGLNWGILAEM
EVGEAYRPLYRLQAILLIAAALFLLGTAFLAAVAAKMFTSPLYRLTDSARKLAAGELDVE
VDVNLQDEFGELATEFKQVGNKLRQTEEELETKKQESDFLLQNILPTAIAERRKQGEATI
ADNLKQVTLLNAHLAGISELNKRLSPQKMTELLTELFDEFDDSAERYGLERQNSLGTSYM
AVCGLTQVRFDHSKRTVDFALDMLDIIQRLNVNYNSALALRISIHAGPVTAGVIGTERFR
YSIWGETAYIVSSLQSQADLNHILVTRSVYERLADSYTFIKSPVVKIQGLGEVEIWTLIT
TKKLAPTQVELVQSSFEKVKPIADRTAELFYQRLFELSPSVRHLFKGEMKEQERKLMHTL
ALAVEGLRQPENIIPAVQDLGRRHAGYGVKTEYYDILSDALLWTLAQVLGVEFTAPVRKA
WEEAYTFLSEIMKEAAAELELKKIGV
Download sequence
Identical sequences K9WM86
gi|428313727|ref|YP_007124704.1| WP_015185431.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]