SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313741|ref|YP_007124718.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313741|ref|YP_007124718.1|
Domain Number 1 Region: 832-982
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-29
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 318-489
Classification Level Classification E-value
Superfamily GAF domain-like 3.93e-29
Family GAF domain 0.0063
Further Details:      
 
Domain Number 3 Region: 480-606
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.06e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.046
Further Details:      
 
Domain Number 4 Region: 180-305
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.48e-20
Family Heme-binding PAS domain 0.023
Further Details:      
 
Domain Number 5 Region: 748-831
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.22e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 
Domain Number 6 Region: 621-736
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.04e-16
Family BphP N-terminal domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428313741|ref|YP_007124718.1|
Sequence length 982
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MLEFVRTLVDAREFIPHGHCYLWKPELVWLHVVADVVTGIAYYSISFLLVYFVHKRRDLP
FNWIFLIFGSFIVACGTTHFFEVWTLWHPTYWLSGLIKAITAWVSVGTAVLLVPLIPQAL
ALPSPAQLEVINLELRNEITQRQEAEKALQRVNEQLEIRVQERTAELATTNESLQAEIEW
RKRQEEVLNRREQEFKALVENAPDIITRFDRDLRHLYINPAITRATGLLPETFIGKTNRD
LGMPEDLIVSWENSVYQVFETGQEKSLEFQFPTPNGLKYYQVRLVPELGNDGAIKSTLSI
ARDISEHKQVEEALLRRSRQLEILSRASHEINTVLEIPTVMRTMMASAIELAGASAGTYG
LNKQGQMVFSEYNQNGKIYSVDITYERGMGVSGWVMETRKPYVSNQAESDPNVLPYLQKA
FTFYNLINIPIFNRKGELIGCFELHNKAKQRPFSDNDITMLQGLAASAAVALENAQMLVE
RQQAEKALRESEQRLAAIFNQAAVGIAQVGLDGKWLLVNQKLCDIVGYTSQELLQQTFQD
ITHPDDLSISLKYLQQMSAGEIQDYSLEKRYVGKNSLSIWINLTASVVRDLSGKSHYFIV
IVEDISERKTTEEERQKLVSLIENSSDFISLASMTGEVLYVSEAGKQLIGLDNNEEVKTT
FILDYLMEEDRVEYLDQIVPALMKNGRWEGEYRFRNFKTNQPIVVHHNCFLIADSRTNEA
IAIATVTRDITERKRAEQEIRELNHNLERRVAERTAELEAINQELESFSYSVSHDLRAPL
RGIDGFSQALLDRYADRFDEKGKHYLQRIRTGTQRMGELIDDLLKLSRVTRSEMHRTQVD
LSALAREIAAELQRTQPERQVEWAIAPGRVAYGDARLLRIVLENLLNNSWKFTSARMLAR
IEFDTKLHEDAKPVYFVHDNGAGFEMAYANKLFGAFQRLHTQAQFPGTGIGLATVQRIIH
RHGGRVWAEAAVEQGATFYFTL
Download sequence
Identical sequences K9WP37
WP_015185445.1.75295 gi|428313741|ref|YP_007124718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]