SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313748|ref|YP_007124725.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313748|ref|YP_007124725.1|
Domain Number 1 Region: 45-298
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.04e-82
Family Tryptophan biosynthesis enzymes 0.0000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428313748|ref|YP_007124725.1|
Sequence length 301
Comment indole-3-glycerol phosphate synthase [Microcoleus sp. PCC 7113]
Sequence
MTHNPLMQIRRRPPSPPVDISIVRYQVKVPDAEPRHILEEIVWHKEAEIDQMRERLPLVE
LRKRVQTAPTPRDFQAALLCGKTRPALIAEVKKASPSKGVIREDFEPVAIAQAYQKGGAT
AISVLTDQKFFQGSWENLSQVRAAIDLPVLCKEFIIYPYQIYLARAYGADAVLLIAAILS
DQDLQYFVKITKSLSMTPLIEVHTLEELDRVLSLDGVTLVGINNRNLEDFSIDLQTTCDL
LEVRSHQLQERNIAVVSESGLHTTADLEQVACAGATAVLIGESLVKQPDPAIAIADLFAK
A
Download sequence
Identical sequences K9WNG8
gi|428313748|ref|YP_007124725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]