SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313769|ref|YP_007124746.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313769|ref|YP_007124746.1|
Domain Number 1 Region: 18-213
Classification Level Classification E-value
Superfamily GAF domain-like 1.46e-55
Family GAF domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 503-670
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.12e-44
Family Histidine kinase 0.00062
Further Details:      
 
Domain Number 3 Region: 194-419
Classification Level Classification E-value
Superfamily GAF domain-like 9.51e-25
Family Phytochrome-specific domain 0.02
Further Details:      
 
Domain Number 4 Region: 432-515
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.22e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313769|ref|YP_007124746.1|
Sequence length 679
Comment bacteriophytochrome (light-regulated signal transduction histidine kinase) [Microcoleus sp. PCC 7113]
Sequence
MSPPKKTKSMSDFLAYGGLLHGITSRIRQSLELQEILTATVTEVRSFLQTDRVKVYRFHP
DESGQVVAESIAIDRLPSLLGLNFPAGDIPPQAREMFVKAHQRSIVDVAAQQIILSSNAA
PRSIVDLSLEDIRLQPIGDILQRPVDSCHLDYLTAMGVLSSLVVPILHQEHLWGLLVSHH
SQPRAFKEEELQLVQLIADQLSIAIAQSELLTQARKQVRRETLINQITHLLHSPRNMPEI
LQLVLEQIVRAASGSGGRLYLSETDKNVRTLYTCGTQPALSTQEQPALLEENSFWQPLMQ
PETQPSQGGDSLHLQIIPDLYEDPQLESLTQAFRPTPIRGLLVMPLYHGSESLGCLTIFR
NAIEIETLWAGYWDKDQRQQRPRASFEVWREYQKSQPPQWTREDIELIESLSLHLAMAIM
QNRLYQLERHNLELNIARVVAEESSRLKSSFLASTSHELRTPLASTLNCLQILRKGFYKN
TEELNKYIQLAEKSVRNIIDMINDVLDITKIEAGSMAVELEPVNLGSLLEELRDLFSLES
QRKAVTLMIECEVNRVYTDKCKLRQVLTNLLSNAFKFTETGSVRIKIIKQEEPPNIEITV
VDTGIGIEISQRELLLEPFVQEDGSIKRRYGGTGLGLAICKRLVELMGGKIHLDSPGKNQ
GTTVTVTLPDSTHSLKDQT
Download sequence
Identical sequences K9WLQ1
gi|428313769|ref|YP_007124746.1| WP_015185469.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]