SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313851|ref|YP_007124828.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313851|ref|YP_007124828.1|
Domain Number 1 Region: 34-208
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.91e-72
Family HD domain 0.00000142
Further Details:      
 
Domain Number 2 Region: 197-413
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.56e-63
Family RelA/SpoT domain 0.0000147
Further Details:      
 
Domain Number 3 Region: 396-468
Classification Level Classification E-value
Superfamily TGS-like 6.54e-22
Family G domain-linked domain 0.073
Further Details:      
 
Domain Number 4 Region: 666-746
Classification Level Classification E-value
Superfamily ACT-like 0.000000000109
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313851|ref|YP_007124828.1|
Sequence length 751
Comment RelA/SpoT family (p)ppGpp synthetase [Microcoleus sp. PCC 7113]
Sequence
MDAIATTSRFNFDVPEWLQECILATSAAANEPVPDDINLISRAFEFAYKLHEGQLRASGE
PYIAHPVAVAGLLRDLGGSSVMIAAGFLHDVVEDTDVTPEEIESRFGVEVRRLVEGVTKL
SKFNFSSKTERQAENFRRMFLAMAADIRVIVVKLADRLHNMRTLEHLNPQKQRSISQETR
EIFAPLANRLGIGRVKWELEDLAFKYLEPESYRQMQQLVAERRTDRETRLSKVGDILRER
LESTEIHCLEISGRPKHLYGIYQKMQRQQKGFHEIYDLAAMRLILQTKEDCYRALAIVHD
AFRPIPGRFKDYIGLPKPNRYQSLHTGVMGPSGRPIEVQIRTLEMHHIAEYGIAAHWKYK
ESGGSSNNRISAEDEKFTWLRQLLEWQNDLKDAQEYMDTIKDNLFDDDVYVFTPNGDVIP
LSRGATPVDFAYRIHSEVGNHCAGARVNGRWTVLDTPLNNGDIVEIITKENSHPSLDWLN
FVATPSARNRIRQWYKRSHRDANVARGKELLEKELGKRGFEALLKSEPMQAAAERCNYHS
VEDLLAALGYGELTLNLVVKRLREAVKARQPLETEPQEPLIPQPPVAKPQATGGAKKIEP
IAGVEGLLHHLAGCCNPIPGEAIIGVVTRTRGISIHRQGCLNVESVPGERVIPVSWNPTD
VAHGRPQTYPVNIQIEVIDRVGVFKDILSRLSDQNINVRNAQVRTQEGRPAIIDLCIDIC
DHQQLERSFCQIKKMSDILNIRRVSQVEEAC
Download sequence
Identical sequences K9WPE6
gi|428313851|ref|YP_007124828.1| WP_015185551.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]