SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313907|ref|YP_007124884.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313907|ref|YP_007124884.1|
Domain Number 1 Region: 1049-1351
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.62e-62
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000379
Further Details:      
 
Domain Number 2 Region: 290-460
Classification Level Classification E-value
Superfamily GAF domain-like 1.83e-55
Family GAF domain 0.00033
Further Details:      
 
Domain Number 3 Region: 469-638
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-55
Family GAF domain 0.0004
Further Details:      
 
Domain Number 4 Region: 649-818
Classification Level Classification E-value
Superfamily GAF domain-like 1.7e-52
Family GAF domain 0.00025
Further Details:      
 
Domain Number 5 Region: 838-1005
Classification Level Classification E-value
Superfamily GAF domain-like 1.24e-47
Family GAF domain 0.00065
Further Details:      
 
Domain Number 6 Region: 115-281
Classification Level Classification E-value
Superfamily GAF domain-like 6.32e-41
Family GAF domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428313907|ref|YP_007124884.1|
Sequence length 1352
Comment methyl-accepting chemotaxis protein [Microcoleus sp. PCC 7113]
Sequence
MTDLSHTHPFNSNHPNGIPVTSDAVDASEVANPSADVFNRATEPNTAATAQSRLGREQEL
TLEELALISSERDRSLAMPPVESQLDSSPSHPQNDQTSVRFKGHFDKQHLKHERQWLSTL
ANQMRQATDQDTLLRLTVTEIHQHLQVDRALIYQFHTDTQGTVVAELMAGGYTPTLGETL
SAIAFGAQNRQDYQQQQVITLEHVYQKAPTPYQLQLLQKFQVKASLSLPIFIEGQVWGLL
TVQQCSGLSRRWQETEIRLLYQVVTEMTTCLQFWEFQAQIQKQAEAAAKEAQAERAVNLV
IEKIRKSLDINTILATTAQEVRKLLDIERITIYKFRPDYFGDFVVESETGGWPKLVGSSW
EDPYLQEHQGGRFRHNEPLVVDDVYNGGLTDCHVEALEDFGVKSCMVVSIFQGKKLWGLL
SAFQHSGPRHWQDNEVKWLSQIAAQLGLALQQAEYLEKLQSQTQQMGKEAERERAIARVI
DKIRQSSDMDAIFRVAAQEVRRLLDVERITIYKFRPDYFGDFMVESETGGWPKLVGSGWE
DPYLQENQGGRFRNNEPLVVDDVYNGGLTDCHVEALEYFGVKSCMVVSIFQGKKLWGLLS
AFQHSGSRHWQDNEVKLLFQIAAQLGLAIQQAEYVAQVKEQSAQIAKGAERERIVASILE
KILKSSDIDTVFKTTVQEVRKVLNVERVTIYKFRPDYFGDFVVESESGGWPKLVGSGWED
PYLQEHKGGRFRDNEVFVVDDIYKTEMTDCHVEALEFFAIKSCLVAPILQGQHLWGLVSA
FQHSKPRHWEEGEVKLLAQIGAQLGLALQQAEYIEEMRVQSQQLAKSVDRGAVYSRLIYR
LGSALIQEHFSLDNVLQLALLELRKQLKCDRVGIYQFNPDWSGQFIVEDVGSDWTKLVGT
DLAIVEDTHLQETRGGRYRRRETFSVDDVYTIGHQECHVQLLEQWDVKAYMIAPIFKGDQ
LWGLLGAYQNDEPRHWEQMDVNLLAQVGVQIGLALQQAEYLEQLRTQAQQLTESAERERG
AKEQLQREVIQLLTAVRPALKGDLTVRAPVTEDEVGTIADAYNNTLQSLRGIVKQVQTAS
RQVAQTSQDSESSIAGLASQAQQQFQFLERTLEQIQTLVNSTNAVSTNAQQVNLAVQQAN
QTVREGDAAMNHTVDGILAIRETVAETSKRLKRLSESSQKVSRVVNLISNFTTQTQLLAL
NAAIEATRAGQYGRGFVVVADEVRSLARQSAEATTEIAQLVQEIQEGTAEVSVAMETGIQ
QVAQGTHLVTNARQNLNAIVEATSQISQLVEGITQATQLQTDQFQSVTQTMTDVAAIANK
TSEDSVEISTSFKELLAMAQNLQASADQFKVD
Download sequence
Identical sequences K9WMQ3
gi|428313907|ref|YP_007124884.1| WP_015185607.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]