SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428313960|ref|YP_007124937.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313960|ref|YP_007124937.1|
Domain Number 1 Region: 443-608
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-51
Family Histidine kinase 0.00044
Further Details:      
 
Domain Number 2 Region: 371-455
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.02e-20
Family Homodimeric domain of signal transducing histidine kinase 0.00089
Further Details:      
 
Domain Number 3 Region: 261-378
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000742
Family Heme-binding PAS domain 0.055
Further Details:      
 
Domain Number 4 Region: 203-250
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000379
Family HAMP domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313960|ref|YP_007124937.1|
Sequence length 612
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MKLRTKILAGYGVALTLVILVCGWGIINIRRLGRASEAILRENYRSILAAENMIDAIERQ
DSATLLVLLGNEEQGTEQFSANEVLFLQWLGRAKDNITIPGEKEVLLNLEKNYKDYLLTF
SQLRRQQLRQTPVSTDYYYDTLLPAFESVRQTSVELRELNQKTMVLASQRTQALSHQAIG
SMAVTGGAAAGLGLGFSLLLSTRLVRPLKEMTRATERIAEGDYDIAITVKSDDELGLLAQ
EITTMSQNLKVFHELNVGQVIAEKQRSESIIRSISDGLVVVDAEFEIIAINPIAAAILNT
TAEQAKGKHFLSVFNHQQLYEYLNITAQTGTPPQLNENQSILSKQTENQAQYYKFAITPV
TTEEGTMLGVVLLLQDVTKLKELDTLKSEFVATASHELRTPLTGMAMSLNLLLETAQQKL
SNREQELLHAAVEDVERLRTLVNDLLDLSKIESGRIELEFIAVEVELLIEKAISILSVQA
QEKQIELTPSIPTDIEPVKADPNKIIWVLINLIANALRYTEAGGHIQVSAQQKDDWVYLS
VADNGLGIPWEYQAKIFDKFVQVKTDKDVGGSGLGLAICKEIVKAHSGTIWVDSAPGEGS
TFTFTLPVVNER
Download sequence
Identical sequences K9WNZ9
WP_015185660.1.75295 gi|428313960|ref|YP_007124937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]