SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314006|ref|YP_007124983.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314006|ref|YP_007124983.1|
Domain Number 1 Region: 545-835
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.62e-24
Family Phosphate binding protein-like 0.0027
Further Details:      
 
Domain Number 2 Region: 140-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000787
Family Protein kinases, catalytic subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428314006|ref|YP_007124983.1|
Sequence length 839
Comment hypothetical protein Mic7113_5975 [Microcoleus sp. PCC 7113]
Sequence
MAKKKKKKNLTKGVVKELGRRASSEAAGRRDYVASTIRSRLESLVPTQLRWLFPFVTGFK
PTLEEEEEAATVATQVKVAESKKAPQILEPVYTQYRCRWGDPLTCEYLQQTVQQSPETKS
CRECGFPATLPEKAEIRGSRGRYRVESLIGRRGMGRLYRGTQLSNSHQVLIKEYLLPDYC
FNPEEAKARKDAFRLKAGVNLADGRVQDFRLCHPWEAIADHNEERCYLLTKGNFDLYPTL
REYLALHGAMSAIAVRQVLNQVLQTLEFLHTQKFRFPSGQVQLGIAHGNLSLDSLLIAKN
QNGAVPNGFNNSAALSSEILNTDFFIYICDLALWESLFDPKGDWGQGTRENQTSTVNRNN
SHHPSLISNPSAAQDLVALGYIGFYLLAGSRINPVNGQPRDPKDDQQWPSINFNFKVFLQ
RLMGIGIPFESAQIARQALLKLPPEAPIVYPVVQAVSEEEEIVKTPRILWFLLGILGFGL
LGMLLWWLWPKPQVAESVGDELSLCCINKVSAIPAGKFTYTAEQEGTWNYTVQQKNLVAD
GKTLEEELEKRQPKLQLNYQPEDSTQTALAKVRSEETNFALTSLITPLPIELESQTVAYD
GLVVFVAFSYSQREKSLPQALNGQITFKQLRQLYTGQITNWRELGGPNLAVRLYIPDETE
AVRIFEQRVLKDNQTIQSFRKLQRKGDPPDTFTNSWVPEIYRFPTFKMLRQVIQDFESEG
AGMGAIAFGKLSQVFGQCSVYPLALKEGEKNFVHPLIQDNQQPVNPTTDLCDHKGSYFPN
LQVFRDNSYPLGYPLAVVYPRDNSRPPVGAKFAEMLRTQEGQQLLSKTGLIPLYPVALK
Download sequence
Identical sequences K9WPX8
WP_015185706.1.75295 gi|428314006|ref|YP_007124983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]