SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314220|ref|YP_007125197.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314220|ref|YP_007125197.1|
Domain Number 1 Region: 475-649
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-45
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 405-485
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.55e-21
Family Homodimeric domain of signal transducing histidine kinase 0.00057
Further Details:      
 
Domain Number 3 Region: 273-410
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000506
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 4 Region: 221-270
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000144
Family HAMP domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314220|ref|YP_007125197.1|
Sequence length 680
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MIVVNQPGSALLKTIREVIAHWWSDFTLQTRLMAAATLAVSLIMSGLTFWAVNTIQQDAR
MNDTRFGRDLGLLLAANVAPQIAENNLTEVARFSHRFYSTTSSVRYMIYADAEGRIFFGI
PFSESEVQNSLTIQRRIELPENYAGNSELPMVRQHLTPDGEVTDVFVPLRHDGKYLGVLA
IGINPNKNVVASSNLTRDVTIAVFISIWVMVILGAVSNALMITKPIKELLTGVKNIAAGN
FKQRIDLPLGGELGELIFSFNEMAERLKSYEEQNIEELTAEKAKLETLVSTIADGAVLID
TNLQVMLVNLTARRIFGWEGCDIVGENVLHHLPSVVTMELTRPLYQIAGGQTAADLDSDD
LRQGEDREGEEFRITLTQPAGRTVRILLTRVFDQYRETLKGIAMTVQDITREVELNEAKS
NFISNVSHELRTPLFNIKSFIETLHEYGEDLTETERREFLETANRETDRLTRLVNDVLDL
SRLETSCRIYHFEPVDIAQPVEQTLRTYQLNVRDKGIELRHDIEPNLPPVLGHYDLLLQV
FDNLVGNALKFTEPGGRIAIRAYLIEPALNHHNESKSVRIEVSDTGIGIDAEDQEAIFER
FFRVENRVHTLEGTGLGLSIVRNIIEKHHSQVHLLSEVGVGTTFWFDLDVFEEKNTGVEQ
TPQVDSSSTNQAPTAASSLI
Download sequence
Identical sequences K9WPR0
gi|428314220|ref|YP_007125197.1| WP_015185920.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]