SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314261|ref|YP_007125238.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314261|ref|YP_007125238.1|
Domain Number 1 Region: 1011-1344
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-98
Family WD40-repeat 0.00000795
Further Details:      
 
Domain Number 2 Region: 738-1053
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.02e-89
Family WD40-repeat 0.0000161
Further Details:      
 
Domain Number 3 Region: 232-353
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-24
Family Toll/Interleukin receptor TIR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 438-566
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.57e-23
Family Toll/Interleukin receptor TIR domain 0.0033
Further Details:      
 
Domain Number 5 Region: 4-95
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-22
Family Toll/Interleukin receptor TIR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428314261|ref|YP_007125238.1|
Sequence length 1390
Comment WD40 repeat-containing protein [Microcoleus sp. PCC 7113]
Sequence
MGNLFDAFISYGRADSKAFATKLHAHLLEQGLNVWFDQNDIPLGVDFQNQIDDGIEKAHN
FLFLIAPHSINSPYCGKEIELALKRNKRIIPLLHVEQITQETWQQRFPTGTVEDWEAYRQ
KGLHSSFPNMHPAIGKINWVYFREGVDDFETSFTGLMSLLSRHRDYVEAHTQFLAKALEW
ERNQKQTSYLLIGEERQQAEAWLKIRFRDEQPPCTPTNLHCEYITESIKNAHNLMTQVFL
SYADEDRATMEKIRNSLRRESITVWTNKTDIQTGEAFEEAIKRGIEQADNLVFLLSPESV
NSTYCQQELDLALSLSKRIIPILVRETDLNQVPSALRSLQYIDLTDNVQEDDYLLDESQL
LKIFHQDAAYYNEHKILLAKALKWKRQHENPSILLRGYNLRSAETWLKVAKKRTQQPPTL
LQEEFIEESLRQLPLESLDVFVSYSRADSDFARKLNDSLQIQGKTTWFDQESIASGSDFQ
QEIYRGIKACNNFLFILSPRSVNSPYCADEVEYAAGLNKRFVTVLHQEINSCDLHPELAK
VQWIDFNHNERDFNANFNQLVRTLDTDRVHVYSHTKWLQRSLEWKQKDKSTDLLLRGSEF
LIAQNWLQETEQQQKKPVATVLQKEFIEASKNAIVAAEKEETRRQSEMLRLQEERTKEAE
ARLALQKKSAKRQKYFLVAVTTALMAAVGFSVVAVNATRKAQAAQAKLINALTYSIESRL
NNYQDFDALIESIRTGRQLQTLEAQDKRKIQQRVKDVWQKAFYRIKEIHRFVGHDGAVLS
LSFSPDGKTIVSGGGDGTIKLWERSGRLLFSIKRHEREISSIRFSPDGQSIASASADGTI
KLWNLKGQPLHTLEGHEGMVTSVSFSPDGQTLASAGEDGTIRLWNQEGKQIKTWQGHTGR
VNTVAFSPDGQRIASGGSDKDNTNNTVRLWDGNGKLLQTFTGHQIVVREVNFSPDGQTII
SASEDHSARLWSITGEELQQFVHSEGVIGANFSPDGQTILTSSFDKTIKLWNLAGQEIRT
IRGHQDWVNEATYSPDGQTIASASSDGTVRLWDSTSSILHQFSNHTDSVYSVHYSPDGKL
LASAGNDGKINLYDSKGEFIRGFPAHTEPIGSVQFSPDGKTLASASGDNTIKLWDLSGQP
INTLDEHEKPITAVRFSPDGQTIASASEDNTVKLWNRQGQLLRTFEGHKGAITNLSFSPD
GQTLASASADQTVKLWSLTGQILHTLQGHQNIVRNVIFSPDGQTIVSTGGDRTIRFWTRT
GQLLKIARGHTASVNSLSFSRDGKLLVSAGEDNTLRVWTASGEPLQILDGHTNWVNDISF
SPEGTTVASASDDQTIIIWNLRSSKVGNQLAGGLSLDQLLTKSCAWVSNYLQHNPTLDKS
DRVLCDGIDH
Download sequence
Identical sequences K9WQJ2
gi|428314261|ref|YP_007125238.1| WP_015185960.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]