SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314263|ref|YP_007125240.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314263|ref|YP_007125240.1|
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily CheY-like 4.55e-37
Family CheY-related 0.00053
Further Details:      
 
Domain Number 2 Region: 232-362
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.55e-25
Family Histidine kinase 0.018
Further Details:      
 
Domain Number 3 Region: 129-202
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000844
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314263|ref|YP_007125240.1|
Sequence length 362
Comment histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MKKILVIEDEQSVRENLLDLLDAEDFETVGAGNGKVGVELANTHLPDLIICDVMMPELDG
FGVLTALRSSPVTEMIPFIFLTAKSDKMDLRQGMSLGADDYLTKPFTRAELLEAISIRLE
KKATLEKHSQKKLDELRNSITLSLPHELRTPLNGILGLSELLVEESDILERQEVREMAQG
IHKSGERLLRLIQNFLLYAELELIATDSERIQALRSGKVSSAASVIKEISVCQARQAGRE
ADLQLELQDSSVQIAKVRLEKIIEELVNNAFKYSLAGTPVRIIAAPIEQMFTLSITDWGR
GMTAAQIAEVGAYRQFERKLYEQQGSGLGLAIAKRLTELLGGELTLDSIPEKQTTVRVVL
PI
Download sequence
Identical sequences K9WPW1
gi|428314263|ref|YP_007125240.1| WP_015185962.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]