SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314265|ref|YP_007125242.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314265|ref|YP_007125242.1|
Domain Number 1 Region: 852-969
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.38e-38
Family Histidine kinase 0.00093
Further Details:      
 
Domain Number 2 Region: 377-505
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.41e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.029
Further Details:      
 
Domain Number 3 Region: 683-765
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.12e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0022
Further Details:      
 
Domain Number 4 Region: 212-339
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000613
Family Heme-binding PAS domain 0.046
Further Details:      
 
Domain Number 5 Region: 509-669
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000177
Family GAF domain 0.008
Further Details:      
 
Domain Number 6 Region: 44-199
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000284
Family GAF domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314265|ref|YP_007125242.1|
Sequence length 978
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MATSSNPLSIHPTLEQEAIDSPFLTIQAAMINQIAQATLGRLVLDDVLHSITQQLQDTLS
VSGCLMIQSDGTPGRTVEDEFGHGLAARSEKVAIAQQNTKVISAEYLSDLCGQVYQFYHS
WLSQGKSVRFPGTGEPIPPEIQDALQENSLSRILIVPLLHSSTYLGGILLYQVENQREWV
DQEIAFVQAIADQCAIALALTKLVQHSATELTQRQESERALHESQRLLQASVARNHALLE
AIPDAIFRVRRDGIYLDGKAAKQDILSVSTIEIIGQHLHQVLPTEVAGLIWHHIELALET
NEMQLVEYHLWVNGKSHHFEARIINSGTDEVVVIVQDITERVEVRVALEQLNDALEIRVA
ERTAALSEANRILRAEIIERHRAQEQLKDSEERFRNLVETSSDWVWEVDENAVYTYASPK
VESLLGYKVSDVLGKTTFDFMLPQERQRVTDFLAQLSASRQPFTCLENTNIHKDGYLVVL
ERSGVPIFDAKGIFRGYRGIDRDITKRKESEKEVQFLHSITRAIFESQDFYAALSIALQK
VCEATGWDFGEAWVPKADGTVLECSPAWFSKTKSLEPFRIASESLTFAPNVGLPGRVWSK
QKPEWRRDVSAESDQVYLRAQLAKEAGLKAALGIPLLTTDGVLAVLVFYMFESKDEDQRL
IELIAASTELGLMIQRKQAEGEIRKALEKEKELTELKSRFISMTSHEFRTPLTTIHSSAE
LLEHYSYKWTEERKLTHLYRIQSSVKHMTKLLNDVLILGKAEADKIELNLVALNLEDFCH
NLVEELQLNDNSQHKIIFTCGWRLGTDQRKVGKGKNRAGMHLTIAPMENFSTPVHQEKGT
LAPGLHPATLKSPQSYMDEKLLRQILENLLSNAIKYSSSGSPVEFTLSYLETQVVFQIRD
RGIGIPIEDQQRLFETFHRATNVGTIAGTGLGLAIVKKCVDVHQGQIAVESEIGVGTTFT
VTLPIYNLEPVHEKNSCD
Download sequence
Identical sequences K9WPV4
gi|428314265|ref|YP_007125242.1| WP_015185964.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]